KEGG   Macaca mulatta (rhesus monkey): 717050
Entry
717050            CDS       T01028                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04141  Protein processing in endoplasmic reticulum
mcc04151  PI3K-Akt signaling pathway
mcc04211  Longevity regulating pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04668  TNF signaling pathway
mcc04728  Dopaminergic synapse
mcc04911  Insulin secretion
mcc04915  Estrogen signaling pathway
mcc04918  Thyroid hormone synthesis
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc05020  Prion disease
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05034  Alcoholism
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    717050 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    717050 (ATF6B)
   04022 cGMP-PKG signaling pathway
    717050 (ATF6B)
   04151 PI3K-Akt signaling pathway
    717050 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    717050 (ATF6B)
   04915 Estrogen signaling pathway
    717050 (ATF6B)
   04926 Relaxin signaling pathway
    717050 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    717050 (ATF6B)
   04918 Thyroid hormone synthesis
    717050 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    717050 (ATF6B)
   04925 Aldosterone synthesis and secretion
    717050 (ATF6B)
   04927 Cortisol synthesis and secretion
    717050 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    717050 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    717050 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    717050 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    717050 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    717050 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    717050 (ATF6B)
   05031 Amphetamine addiction
    717050 (ATF6B)
   05034 Alcoholism
    717050 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    717050 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    717050 (ATF6B)
   05161 Hepatitis B
    717050 (ATF6B)
   05163 Human cytomegalovirus infection
    717050 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    717050 (ATF6B)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    717050 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 ZapB GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 717050
NCBI-ProteinID: XP_014991523
Ensembl: ENSMMUG00000015229
LinkDB
Position
4
AA seq 711 aa
MVGGWGGKMAELMLLSEIADPTRFFADNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCP
EQDVPFDGSSLDVGMDVSPPEPPWELLPILPDLQVKSEPSSPCSSSSRSSESSHLSTEPS
SEALGVGEVLHVKTESLAPPLCLLGDDLTSSFETVQINVVPTSDDCSDVQTKIEPVSPCS
SINSEASLLSADSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSPDGS
SGKALPIRKPPLQPKPVVLTTVPMPPRAVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQP
EGPAAALPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFG
PVSISEPPSAPVSPRMNKGEPRPRRHLLGFSEQEPVHGVEPLQGSSQGPEEPQPSPTDQP
SFRNLTTFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQ
RAQERQKSQPRKKSPPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTF
YVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDT
RVIHIKTSTVPPSLRKQPSPTPGNATGGPLPASAASQAHQASHQPLYLNHP
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggttggggggtgggggggaaagatggcggagctgatgctcctcagcgagattgccgac
ccgacgcgtttcttcgccgacaacctgctgagcccggaggactggggtctgcagaacagc
accttgtattctggcctagatgaagtggccgaggagcagacgcagctcttccgttgcccc
gagcaggatgtcccgtttgacggcagctccctggacgtggggatggatgtcagcccccct
gagcccccatgggaactcctgccgatcttgccagatcttcaggtgaagtctgagccgtct
tccccctgctcttcctcctcccgcagctccgagtcatcacatctctccacagagccctcc
agcgaggctcttggggtaggggaggtgctccatgtgaagacagagtccttggcaccccca
ctgtgtctcctgggagatgacctaacatcctcatttgaaactgtccagatcaacgtagtc
cccacttctgatgattgctcagatgtccagaccaagatagaacctgtctctccatgttct
tccatcaactctgaggcctccctgctctcagccgactcctccagccaggcttttatagga
gaggaggtcctggaagtgaagacagagtccctatccccttcagggtgcctcctatgggat
gtcccagccccctcacttggagctgtccagatcagcatgggcccatcccctgatggctcc
tcagggaaagccctgcccatccggaagccaccactgcagcccaaacctgtggtgctaacc
actgtcccaatgccacccagagctgtgcctcccagcaccaccgtccttctgcagcccctt
gtccagccacccccagtatccccagttgtcctcatccagggtgctattcgagtccagcct
gaagggccggctgccgctctcccacggcctgagaggaagagcatcgttcctgctcctatg
cctggaaactcctgcccgcctgaagtggatgcaaagctgctgaagcggcagcagcgaatg
atcaagaaccgggagtcagcctgccagtcccggagaaagaaaaaagagtatctgcagggg
ctggaggctcggctgcaggcagtgctggctgacaaccagcagctccgccgggagaatgct
gccctccggcggcggctggaggccctgctggctgaaaacagcgagctcaagttagggtct
ggaaacaggaaggtggtctgcatcatggtcttccttctcttcattgccttcaactttgga
cccgtcagcatcagtgagcctccttcagctcctgtctctcctcggatgaacaagggggag
cctcgaccccggagacacttgctggggttctcagagcaagagccagttcatggagttgaa
cctctccaggggtcctcccagggccctgaagagccccagcccagccccacagaccagccc
agtttcaggaacctgacaaccttccctgggggcgccaaggagctactactaagagaccta
gaccagctcttcctctcctctgattgccggcacttcaaccgcaccgagtccctgaggctt
gctgacgagctgagtggctgggtccagcgccaccagagaggccggcggaagatccctcag
agggcccaggagagacagaagtctcagccacggaagaagtcacctccagttaaggcagtc
cccatccaaccccctggacccccggaaagggattctgtgggccagctgcagctatatcgc
cacccagaccgttcgcagccagcgttcttggatgcaattgaccgacgggaagacacgttt
tatgttgtctctttccgaagagaccacctgctgctcccagccatcagccacaacaagacc
tcccggcccaagatgtccctggtgatgccggccatggcccccaatgagaccctgtcaggc
cgtggggccccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacacc
agggtgattcacatcaagacctccacggtgcccccctcgctccgaaaacagccatcccca
accccaggcaatgccacaggtggccccttgccagcttctgcagccagccaggcccatcag
gcctcccaccagcccctctacctcaatcatccctga

DBGET integrated database retrieval system