KEGG   Macaca mulatta (rhesus monkey): 717161
Entry
717161            CDS       T01028                                 

Gene name
RASGRF1
Definition
(RefSeq) ras-specific guanine nucleotide-releasing factor 1 isoform X1
  KO
K04349  Ras-specific guanine nucleotide-releasing factor 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    717161 (RASGRF1)
   04014 Ras signaling pathway
    717161 (RASGRF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    717161 (RASGRF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcc04990]
    717161 (RASGRF1)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   717161 (RASGRF1)
SSDB
Motif
Pfam: RasGEF RhoGEF PH RasGEF_N GOLGA2L5 PH_11 PH_13 IQ PH_9 Sec34
Other DBs
NCBI-GeneID: 717161
NCBI-ProteinID: XP_028707051
LinkDB
Position
7
AA seq 1260 aa
MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEIAS
LLKDNERIQSTQTVAPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEEAKGSS
QDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNT
FLHSYRVFTTAVVVLDKLITIYKKPISAIPARWLRSLELLFASGQNNKLLYGDPPKSPRA
TRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCNSNGYTSMYSAMSPFS
KATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSVLSKQSSEVSVREESDTDQNQSDDGD
TETSPTKSPTTPKSVKSKNSSEFPLFSYNNGVVMTSCRELDNNRSALSAASAFAIATAGA
NEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETND
ELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEP
FENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLI
ASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSK
QTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLV
NFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESLYESSLRIEPKLPT
NT seq 3783 nt   +upstreamnt  +downstreamnt
atgcagaaggggatccggctgaacgatggccatgtcgcgtccctgggactgctggcgcgc
aaagacggcacgcgcaaaggctacctgagtaagcggagttcagacaacacaaaatggcaa
accaagtggttcgcgctgctgcagaacctgctcttctacttcgagagcgactcgagctcg
cggccctcggggctttacctgctggagggctgcgtctgcgaccgcgcgccctcccccaag
ccggcgctgtcggccaaggagcctctggagaaacagcattacttcacggtgaacttcagc
catgagaaccagaaagccttggagctgaggacagaggacgcaaaagattgtgatgaatgg
gtggcagccattgcacatgccagctacaggaccctggccacagagcatgaggcattaatg
cagaagtacctgcacctgctgcagatcgtggagacggaaaagaccgtagccaagcagctt
cggcagcagatcgaggatggggagatcgagatcgagcggctgaaggcagagatcgcatcc
ctgctcaaggacaatgagcgcatccagtccacccagactgttgctcccaacgatgaagac
agcgacatcaagaaaattaagaaggtgcagagcttcctgcggggctggctgtgccggcgg
aagtggaagaccatcatccaggactacattcggtcaccccatgccgacagcatgcgcaag
aggaaccaggtggtgttcagcatgctggaggctgaggctgagtacgtgcagcagctgcac
atccttgtcaacaatttcctgcgcccactgcggatggccgccagctccaagaagcctccc
atcacacatgacgatgtcagcagcatcttcctgaacagtgaaaccatcatgtttttacat
cagatcttttaccaaggcctgaaggcccgcatctccagctggcccacgctagtcctggct
gacctgtttgacatcctgctgcccatgctcaacatctaccaagagtttgtccgcaaccac
cagtatagcctgcagatcctggcccactgcaagcagaaccgtgactttgacaagctgctg
aagcactacgaggccaagcctgactgcgaggagaggacgctggagaccttcctcacctac
cccatgttccagatccccaggtacatattgaccctccacgagctcctggcccacacacct
catgagcacgttgagcgcaacagcctggattacgccaagtccaaactggaggagctgtcc
aggataatgcacgatgaagtaagtgagacagagaacatccggaaaaacctggccatcgag
cgcatgatcatcgaaggctgtgagatcctcctggacaccagccagacctttgtgagacaa
ggttccctcatccaggtgcccatgtctgaaaagggcaagatcaccagagggcgcctgggg
tctctctccctaaagaaagagggtgaacgacagtgcttcctgttttctaagcatctgatt
atctgtaccagaggctctggagggaagcttcacctgaccaagaatggagtcatatccctc
attgactgcactttattggaggagccagaaagcacggaggaggaagccaaaggatccagc
caagacatagatcacttggattttaaaatcggggtggagccaaaggattccccgcccttt
acggtcatcctagtggcctcgtccagacaggagaaggcggcgtggaccagtgacatcagc
cagtgtgtggataacatccgatgcaatgggctcatgatgaacgcgtttgaagaaaattcc
aaggtcactgtgccacagatgatcaagtctgacgcctccttatattgtgatgatgttgac
attcgcttcagcaaaaccatgaactcctgcaaagtgcttcagatccgctacgccagcgtg
gagcggctgctggagaggctgacagacctgcgcttcctgagcatcgacttcctcaacacc
ttcctgcactcctaccgggtcttcaccaccgccgtcgtggtcctggacaagctcattacc
atctacaagaagcctatcagtgccatacctgccaggtggctgaggtcgctggagcttctg
tttgccagtggccagaacaacaagcttctgtacggtgacccccccaagtccccgcgcgcc
acccgcaagttctcctcgccaccacctctgtccatcaccaagacatcttcgccaagccgc
cggcggaagctctccctgaacatccccattatcaccggcggcaaggccctggacctggcc
gccctcagctgcaactccaatggctacaccagcatgtactcggccatgtcacccttcagc
aaggccacactggacaccagcaagctctatgtgtccagcagcttcaccaacaagattcca
gatgagggcgatacgacccctgagaagcccgaagacccttcagtgctcagcaagcagagc
tcagaagtctccgtgagagaggagtcagatactgatcaaaaccagagtgatgatggtgat
actgaaacatcaccaactaaatctccaacaacacccaaatcagtcaaaagcaaaaattct
tcagagttcccgcttttttcctataacaacggagtcgtcatgacctcctgtcgcgaactg
gacaataaccgcagtgccttgtcagctgcctccgcctttgccatagcaaccgcgggggcc
aacgagggcaccccaaacaaggagaagtaccggaggatgtccttagccagtgcagggttt
cccccagaccagaggaatggagacaaggagtttgtgatccgcagagcagccaccaatcgt
gtcttgaacgtgctccgccactgggtgtccaagcactctcaggactttgaaaccaacgat
gagctcaaatgcaaggtgatcggcttcctggaagaagtcatgcacgacccggagctcctg
acccaggagcggaaggctgcagccaacatcatcaggactctgacccaggaggacccaggt
gacaaccagatcacgctggaggagatcacacagatggctgaaggcgtgaaggctgagccc
tttgaaaaccactcggccctagagattgcggagcagctgaccctgctagaccacctcgtc
ttcaagaagattccttatgaggagttcttcggacaaggatggatgaaactggaaaagaat
gaaaggaccccttatatcatgaaaaccaccaagcacttcaatgatatcagtaacttgatt
gcttcagaaatcatccgcaatgaggacatcaatgccagggtgagcgccatcgagaagtgg
gtggccgtggctgacatctgccgctgcctccacaactacaatgctgtgctggagatcacc
tcatccatgaaccgcagtgcaatcttccggctcaaaaagacatggctcaaagtctctaag
cagactaaagctttgattgataagctccaaaagcttgtgtcatctgagggcagatttaag
aatctcagagaagctctgaaaaattgtgacccaccctgtgtcccttacctggggatgtac
ctcaccgacctggccttcatcgaggaggggacgcccaattacacggaagacggcctggtc
aacttctccaagatgaggatgatatcccatattatccgagagattcgccagtttcaacaa
actgcctacaaaatagagcaccaagcaaaggtaacgcaatatttactggaccaatctttt
gtaatggacgaagaaagcctctacgagtcttctctccgaatagaaccaaaactccccacc
tga

DBGET integrated database retrieval system