KEGG   Macaca mulatta (rhesus monkey): 717616
Entry
717616            CDS       T01028                                 

Gene name
MAVS
Definition
(RefSeq) mitochondrial antiviral-signaling protein
  KO
K12648  mitochondrial antiviral-signaling protein
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05164  Influenza A
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    717616 (MAVS)
   04622 RIG-I-like receptor signaling pathway
    717616 (MAVS)
   04623 Cytosolic DNA-sensing pathway
    717616 (MAVS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    717616 (MAVS)
   05160 Hepatitis C
    717616 (MAVS)
   05171 Coronavirus disease - COVID-19
    717616 (MAVS)
   05164 Influenza A
    717616 (MAVS)
   05162 Measles
    717616 (MAVS)
   05168 Herpes simplex virus 1 infection
    717616 (MAVS)
   05169 Epstein-Barr virus infection
    717616 (MAVS)
SSDB
Motif
Pfam: CARD_2
Other DBs
NCBI-GeneID: 717616
NCBI-ProteinID: NP_001036131
Ensembl: ENSMMUG00000017150
UniProt: Q0PF18
LinkDB
Position
10
AA seq 541 aa
MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFS
TLQRRPGWVESFIAALRDCELADLADEVACVYQSYQPRTSDRPPDPLEPPSLPAEGPGPP
TPAATHSIPYNGYREKEPSYPMPVQETQAPDSPGESSEQAPQTLNPRVIPRSPDGGPLEP
SSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLIPSRGPVSPSVSFQPLARSTPRASRL
PGPAGSVVSTGTSSSSSSSSPGLASAGAAEGEQGAESDQAEPIICSSGAEAPANSLPSKV
PTTLMPVNTVAPKVPANPASASTVPSKLPTSSKPPGTVPSVFTNPAPSKLPINSTRAGMV
PSKVPASMVRTKVSASTVPTDRSSRTEETSAAPTPAGATGGRSAWLDSSSENGGFESELS
KPGILVSQADSQFSGCSEDLAISASTSLGMGPCRGPEENEYKSEGTFGIHVAENPSIQLM
EGNPGPPADPQGGPRPHIDQKFQEREGPCHRPSPGALWLQAAVAGVLVVTLLVAMYRRRL
H
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgccgtttgctgaagacaagacctataagtatatctgccgcaatttcagcaatttttgc
aatgtggatgttgtagagattctgccttacctgccctgcctcacagcaagagaccaggat
cgactgcgggccacctgcacactctcagggaaccgggacaccctctggcatctcttcagt
acccttcagcggcggcccggctgggttgagtccttcattgcggcgctgagggactgtgag
ctagctgatctcgcggacgaagtggcctgtgtctaccagagctaccagcctcggacctcg
gaccgtcccccagacccactggagccaccgtcacttcctgctgaggggccagggcccccc
acacctgctgcgacccacagtatcccctacaacggctacagagagaaggagccaagttac
cccatgcctgtccaggagacccaggcgccagactccccaggagagagttcagagcaagcc
ccacagacactcaaccccagagtcatcccaaggagtccagatggtggccccctggagccc
tcctctgacctggcagccctcagccctctgacctccagcgggcatcaggagcaggacaca
gaactgggcagtacccacacagcaggtgcaacctccagcctcataccatcccgtgggcct
gtgtctccatctgtctccttccagcccctggcccgttccacccccagggcaagccgcttg
cctggacctgcagggtcagttgtatctactggcacctcgtcctcctcctcctcctcatcc
cctggcttggcctctgcaggggctgcagagggtgaacagggtgcagagagtgaccaggct
gagcctatcatctgctccagtggggcagaggcacctgccaactctctgccctccaaagtg
cctaccaccttgatgcctgtgaacacagtggccccgaaagtgcctgccaacccagcatct
gccagcacagtgccctccaagttgccaactagctcaaagccccctggtacagtgccttct
gtgttcaccaatccagcaccatccaaattgcccatcaactcaacccgtgctggcatggtg
ccatccaaagtgcctgctagcatggtgcgcaccaaggtgtctgccagcacagtccccact
gacaggagcagcagaactgaggagacctcagcagctccaacacctgcaggcgccactgga
ggccgctcagcctggctagacagcagctctgagaatgggggctttgagtcggagctgagt
aagcctggcatactggtatcccaggcagacagccagttctcaggctgctctgaggatctt
gccatcagtgccagcacctccctgggcatggggccctgccgtggcccagaggagaatgag
tacaagtccgagggcacctttgggatccacgtggctgagaaccccagcatccagctcatg
gagggcaaccctgggccacctgcggacccgcagggtggccccaggccacacatcgaccag
aagttccaggagagggaggggccatgccacaggccctcacctggggctctgtggctccag
gcggctgtggcaggggtgctggtagtcacactcctggtggcgatgtaccggcggcgcctg
cactag

DBGET integrated database retrieval system