KEGG   Macaca mulatta (rhesus monkey): 717740
Entry
717740            CDS       T01028                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc01524  Platinum drug resistance
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04140  Autophagy - animal
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04370  VEGF signaling pathway
mcc04510  Focal adhesion
mcc04722  Neurotrophin signaling pathway
mcc04910  Insulin signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc05010  Alzheimer disease
mcc05014  Amyotrophic lateral sclerosis
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05165  Human papillomavirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05210  Colorectal cancer
mcc05211  Renal cell carcinoma
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05220  Chronic myeloid leukemia
mcc05221  Acute myeloid leukemia
mcc05223  Non-small cell lung cancer
mcc05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    717740 (BAD)
   04014 Ras signaling pathway
    717740 (BAD)
   04370 VEGF signaling pathway
    717740 (BAD)
   04024 cAMP signaling pathway
    717740 (BAD)
   04022 cGMP-PKG signaling pathway
    717740 (BAD)
   04151 PI3K-Akt signaling pathway
    717740 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    717740 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    717740 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    717740 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    717740 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    717740 (BAD)
   04919 Thyroid hormone signaling pathway
    717740 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    717740 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    717740 (BAD)
   05203 Viral carcinogenesis
    717740 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    717740 (BAD)
   05212 Pancreatic cancer
    717740 (BAD)
   05225 Hepatocellular carcinoma
    717740 (BAD)
   05221 Acute myeloid leukemia
    717740 (BAD)
   05220 Chronic myeloid leukemia
    717740 (BAD)
   05218 Melanoma
    717740 (BAD)
   05211 Renal cell carcinoma
    717740 (BAD)
   05215 Prostate cancer
    717740 (BAD)
   05213 Endometrial cancer
    717740 (BAD)
   05223 Non-small cell lung cancer
    717740 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    717740 (BAD)
   05014 Amyotrophic lateral sclerosis
    717740 (BAD)
   05020 Prion disease
    717740 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    717740 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    717740 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    717740 (BAD)
   05161 Hepatitis B
    717740 (BAD)
   05160 Hepatitis C
    717740 (BAD)
   05162 Measles
    717740 (BAD)
   05168 Herpes simplex virus 1 infection
    717740 (BAD)
   05165 Human papillomavirus infection
    717740 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    717740 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    717740 (BAD)
   01524 Platinum drug resistance
    717740 (BAD)
   01522 Endocrine resistance
    717740 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 717740
NCBI-ProteinID: NP_001252885
Ensembl: ENSMMUG00000012952
UniProt: A0A1D5QBW1
LinkDB
Position
14
AA seq 167 aa
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPTSSSH
HGGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
NT seq 504 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcctagtgagcaggaagactccagctctgcagagagg
ggcctgggccccagccccgcgggggacaggccctcagactccggcaagcatcatcgccag
gccccaggcctcctgtgggacgccagtcaccagcaggagcagccaaccagcagcagccat
catggaggcgctggggctgtggagacccggagtcgccacagctcctaccccgcggggacg
gaggaggacgaagggatggaggaggagcccagcccctttcggggccgctcgcgctccgcg
ccccccaacctctgggcagcacagcgttatggccgcgagctccggaggatgagtgacgag
tttgtggactcctttaagggacttcctcgcccgaagagcgcgggcacagcgacgcagatg
cggcaaagctccagctggacgcgagtcttccagtcctggtgggatcggaacttgggcagg
ggaagctccgcaccctcccagtga

DBGET integrated database retrieval system