KEGG   Macaca mulatta (rhesus monkey): 717755
Entry
717755            CDS       T01028                                 

Gene name
RAC1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1 isoform X1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04145  Phagosome
mcc04151  PI3K-Akt signaling pathway
mcc04310  Wnt signaling pathway
mcc04360  Axon guidance
mcc04370  VEGF signaling pathway
mcc04380  Osteoclast differentiation
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04530  Tight junction
mcc04620  Toll-like receptor signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04670  Leukocyte transendothelial migration
mcc04722  Neurotrophin signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc04932  Non-alcoholic fatty liver disease
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc04972  Pancreatic secretion
mcc05014  Amyotrophic lateral sclerosis
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05100  Bacterial invasion of epithelial cells
mcc05132  Salmonella infection
mcc05135  Yersinia infection
mcc05163  Human cytomegalovirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05205  Proteoglycans in cancer
mcc05210  Colorectal cancer
mcc05211  Renal cell carcinoma
mcc05212  Pancreatic cancer
mcc05231  Choline metabolism in cancer
mcc05416  Viral myocarditis
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    717755 (RAC1)
   04014 Ras signaling pathway
    717755 (RAC1)
   04015 Rap1 signaling pathway
    717755 (RAC1)
   04310 Wnt signaling pathway
    717755 (RAC1)
   04370 VEGF signaling pathway
    717755 (RAC1)
   04071 Sphingolipid signaling pathway
    717755 (RAC1)
   04024 cAMP signaling pathway
    717755 (RAC1)
   04151 PI3K-Akt signaling pathway
    717755 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    717755 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    717755 (RAC1)
   04520 Adherens junction
    717755 (RAC1)
   04530 Tight junction
    717755 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    717755 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    717755 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    717755 (RAC1)
   04662 B cell receptor signaling pathway
    717755 (RAC1)
   04664 Fc epsilon RI signaling pathway
    717755 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    717755 (RAC1)
   04670 Leukocyte transendothelial migration
    717755 (RAC1)
   04062 Chemokine signaling pathway
    717755 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    717755 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    717755 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    717755 (RAC1)
   04380 Osteoclast differentiation
    717755 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    717755 (RAC1)
   05205 Proteoglycans in cancer
    717755 (RAC1)
   05203 Viral carcinogenesis
    717755 (RAC1)
   05231 Choline metabolism in cancer
    717755 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    717755 (RAC1)
   05212 Pancreatic cancer
    717755 (RAC1)
   05211 Renal cell carcinoma
    717755 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    717755 (RAC1)
   05020 Prion disease
    717755 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    717755 (RAC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    717755 (RAC1)
   05416 Viral myocarditis
    717755 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    717755 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    717755 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    717755 (RAC1)
   05135 Yersinia infection
    717755 (RAC1)
   05100 Bacterial invasion of epithelial cells
    717755 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    717755 (RAC1)
   05163 Human cytomegalovirus infection
    717755 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    717755 (RAC1)
   05169 Epstein-Barr virus infection
    717755 (RAC1)
Membrane trafficking [BR:mcc04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    717755 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    717755 (RAC1)
  Macropinocytosis
   Ras GTPases
    717755 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    717755 (RAC1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   717755 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   717755 (RAC1)
  Exosomal proteins of colorectal cancer cells
   717755 (RAC1)
  Exosomal proteins of bladder cancer cells
   717755 (RAC1)
GTP-binding proteins [BR:mcc04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    717755 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 717755
NCBI-ProteinID: XP_014988754
UniProt: H9ZBW3
LinkDB
Position
3
AA seq 211 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTVGETYGKDITSRGKDKPIADVFLICFSLVSPASFENVRAKWYPEV
RHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALT
QRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
NT seq 636 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaaaacttgcctactg
atcagttacacaaccaatgcatttcctggagaatatatccctactgtctttgacaattac
tctgccaatgttatggtagatggaaaaccggtgaatctgggcttatgggatacagctgga
caagaagattatgacagattacgccccctatcctatccgcaaacagttggagaaacgtac
ggtaaggatataacctcccggggcaaagacaagccgattgccgatgtgttcttaatttgc
ttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgaggtg
cggcaccactgtcccaacactcccatcatcctagtgggaactaaacttgatcttagggat
gataaagacacgatcgagaaactgaaggagaagaagctgactcccatcacctatccacag
ggtctagccatggctaaggagattggtgctgtgaaatacctggagtgctcggcgctcaca
cagcgaggcctcaagacagtgtttgacgaagcgatccgagcagtcctctgcccacctccc
gtgaagaagaggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system