KEGG   Macaca mulatta (rhesus monkey): 717980Help
Entry
717980            CDS       T01028                                 

Gene name
GPI
Definition
(RefSeq) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00010  Glycolysis / Gluconeogenesis
mcc00030  Pentose phosphate pathway
mcc00500  Starch and sucrose metabolism
mcc00520  Amino sugar and nucleotide sugar metabolism
mcc01100  Metabolic pathways
mcc01200  Carbon metabolism
Module
mcc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mcc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    717980 (GPI)
   00030 Pentose phosphate pathway
    717980 (GPI)
   00500 Starch and sucrose metabolism
    717980 (GPI)
   00520 Amino sugar and nucleotide sugar metabolism
    717980 (GPI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    717980 (GPI)
Enzymes [BR:mcc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     717980 (GPI)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   717980 (GPI)
  Exosomal proteins of other body fluids (saliva and urine)
   717980 (GPI)
  Exosomal proteins of colorectal cancer cells
   717980 (GPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-GeneID: 717980
NCBI-ProteinID: XP_014979008
UniProt: I0FQZ3
LinkDB All DBs
Position
19
AA seq 558 aa AA seqDB search
MAALTRDPQFQKLQQWYREHGSELNLRRLFDADKDRFNHFSLTLNTNHGHILLDYSKNLV
TEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMP
EVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSEGPR
VWYVSNIDGTHIAKTLTQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVA
KHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGA
HWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESN
GKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGL
HHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFT
KLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDA
STNGLINFIKQQREARVQ
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggccgctctcacccgggacccccagttccagaagctgcagcaatggtatcgcgagcac
ggctccgagctgaacctgcgccgcctcttcgatgccgacaaggatcgcttcaaccacttc
agcctgaccctcaacaccaaccatgggcatatcctgctggattactccaagaacctggtg
acggaggatgtgatgcggatgctggtggacctggccaagtccaggggcgtggaggccgcc
cgggagcggatgttcaatggtgagaagatcaactacaccgagggtcgagctgtgctgcac
gtggctcttcggaaccggtcaaacacacccatcctggtagatggcaaggatgtgatgcca
gaggtcaacaaggttctggacaagatgaagtctttctgccagcgtgtccggagcggtgac
tggaaggggtacacaggcaagaccatcacggacgtcatcaacattggcattggcggctcc
gacctgggacccctcatggtgactgaagcccttaagccatactcttcagaaggtccccgc
gtctggtatgtctccaacattgatggaactcacattgccaaaaccctgacccagctgaac
cccgagtcctccctgttcatcatcgcctccaagacctttaccacccaggagaccatcacg
aatgcggagacggcgaaggagtggtttctccaggcggccaaggatccttctgcagtggcg
aagcacttcgttgccctgtctactaacacaaccaaagtgaaggagtttggaattgaccct
caaaacatgttcgagttctgggattgggtgggaggacgctactcgctgtggtcggccatc
ggactctccattgccctgcacgtgggttttgacaacttcgagcagctgctctcgggggct
cactggatggaccagcacttccgcacgacgcccctggagaagaacgcccctgtcctgctg
gccctgctgggtatctggtacatcaactgctttgggtgtgagacgcatgccatgctgccc
tatgaccagtacctgcaccgctttgctgcgtacttccagcagggcgacatggagtccaat
gggaaatacatcaccaaatctggcacccgtgtggaccaccagacaggccccattgtgtgg
ggggagcctgggaccaatggccagcatgctttttaccagctcatccaccaaggcaccaag
atgataccctgtgacttcctcatcccggtccagacccagcaccccatacggaagggtttg
catcacaagatcctcctggccaacttcctggcccagacggaagccctgatgagggggaaa
tcaacagaggaggcccgaaaggagctccaggctgcaggcaagagtccagaggaccttgag
aggctgctgccacataaggtctttgaaggaaatcgcccaaccaactctattgtgttcacc
aagctcacaccatttatgcttggagccttggtcgccatgtatgagcacaagatcttcgtt
cagggcatcatctgggacatcaacagctttgaccagtggggagtggagctgggaaagcag
ctggctaagaaaattgagcctgagcttgatggcagtgctcaagtgacctctcatgatgct
tccaccaacgggcttatcaacttcatcaagcagcagcgcgaggccagagtccaataa

DBGET integrated database retrieval system