KEGG   Macaca mulatta (rhesus monkey): 718092Help
Entry
718092            CDS       T01028                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04020  Calcium signaling pathway
mcc04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    718092 (CACNA1E)
   04020 Calcium signaling pathway
    718092 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    718092 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcc04040]
    718092 (CACNA1E)
Ion channels [BR:mcc04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   718092 (CACNA1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 718092
NCBI-ProteinID: XP_014977896
Ensembl: ENSMMUG00000014498
UniProt: A0A1D5Q7C3
LinkDB All DBs
Position
1
AA seq 2455 aa AA seqDB search
MVPEMRGLSPDRRLPEPSPCPAARSPEPGSAGRRRRHVLALPEEEAWRPQQCALLEADAS
FEVGMLPASPRAASGFDNFFPVQEGEGPGWEGAVALEAGSSPFLPVSPEVMKRRRGGLIE
QRDIIKAHEAHKMQSTPQARRKEWEMARFGEAVVARPGSGDGDSDQSRNRQGTPVPASGQ
AAAYKQTKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMI
LATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSY
LRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIM
KAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPA
GYECKDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLI
IIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVML
AEENKNAGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGV
SYFRHKERLLRISIRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLF
LGLFLLEMSLKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALR
LLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGT
PSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLL
NVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHH
MSMWEPRSSHLRERRRRHHMSVWEQRTSQLRKHMQMSSQEALNREEAPSMNPLNPLSSLN
PLNTHSSLYRRPRAIEGLALGLALEKFEEERISRGGSLKGDGGDRSSALDNQRTPLSLGQ
REPPWLARPCHGNCDPTQQEAGGGEAVVTFEDRARHRQSQRRSRHRRVRTEGKESSSASR
SRSASQERSLDEAMPTEGEKDPELRGNHGAKEPTIQEERAQDLRRTNSLMVSRGSGLAGG
LDEANAPLVLPHPELEVGKDMVPTEQEPEGSSEQALLGDVQLDMGRVISQSEPDLSCITA
NTDKATTESTSVTVAIPDVGPLVDSTVVHISNKTDGEASPLKEAEIREDDEEVENKKQKK
EKRETGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLT
NSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFA
LANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKL
FMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNI
IWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIF
VALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSP
SFEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYF
RDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLW
TFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFR
SATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLF
VAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLG
KRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKE
TLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPM
FQRMEPSSLPQEIIANAKALPYLQQDPVSGLSGRSGYPSMSPLSPQEIFQLACMDPADDG
QFQEQQSLEPEVSELKSVQPSNHGIYLPSDTQEHAGSGRASSMPRLTVDPQVVTDPSSMR
RSFSTIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRS
GGRERGRSKERKHLLSPDVSRCNSEERGTQADWESPERRQSRSPSEGRSQTPNRQGTGSL
SESSIPSVSDTSTPRRSRRQLPPIPPKPRPLLSYSSLIRHVGSISPPADGSEEGSPLTSQ
ALENNNTCLTESSNSPHPRQGQHASPQRYISEPYLALHEDSHASDCGEEETLTFEAAVAT
SLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGMMCGAVNNLLSDTEEDDKC
NT seq 7368 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccgagatgcgtggactgagcccagaccgcaggctgcccgagccctccccgtgc
ccggctgcgaggagccctgagcccgggtccgcgggccgccgccgccgccacgtcctggcc
ctgccggaggaagaggcatggcggccccagcagtgcgctctgctcgaggccgacgcctcg
ttcgaggtgggcatgctgccggcctccccgcgcgccgcctctggcttcgacaacttcttc
ccggtgcaggagggcgagggcccgggctgggagggcgccgtggcactggaggcgggctcc
agccctttcctcccggtgagccccgaggtcatgaagcggcggcgtgggggcctcatcgag
cagcgcgacatcatcaaggcccacgaggcgcacaagatgcagagcaccccgcaggcccgg
cgcaaggaatgggagatggctcgcttcggggaggcggtggtcgccaggccggggtccggc
gatggagactcggaccagagcaggaaccggcaaggaacccccgtgccggcctcggggcag
gcggccgcctacaagcagacgaaagcgcagagggcgcggactatggctttgtacaacccc
attcccgtccggcagaactgtttcaccgtcaacagatccctgttcatcttcggagaagat
aacattgtcaggaaatatgccaagaagctcatcgattggccgccatttgagtacatgatc
ctggccaccatcattgccaactgcatcgtcctggccctggagcagcatcttcctgaggac
gacaagacccccatgtcccgaagactggaaaagacagaaccttatttcattggaatcttt
tgctttgaagctgggatcaaaattgtggccctggggttcatcttccataagggttcatac
ctccgcaatggctggaatgtcatggacttcatcgtggtcctcagtggcatcctggccact
gcgggaacccacttcaacactcacgtggacctgaggaccctccgggctgtgcgtgtcctg
cggcccttgaagctcgtgtcagggatacctagcctgcagattgtgttgaagtccatcatg
aaggccatggtacctcttctgcagattggccttctgctcttctttgccatcctgatgttt
gctattattggcttggagttctacagtgggaagttacatcgagcatgcttcatgaacaat
tcaggtattctagaaggatttgacccccctcacccgtgtggcgtgcagggctgcccagct
ggttatgaatgcaaggactggatcggccccaatgatgggatcacccagtttgataacatc
ctttttgctgtgctgactgtcttccagtgcatcaccatggaagggtggaccaccgtgctg
tacaataccaatgatgccttaggagccacctggaattggctgtacttcatccccctcatc
atcattggatccttctttgttctcaacctagtcctgggagtgctttccggggaatttgcc
aaagagagagagagagtggagaaccgaagggctttcatgaaactgcggcgccagcagcag
attgagcgtgagctgaatggctaccgtgcctggatagacaaagcagaggaagtcatgctc
gctgaagaaaataaaaatgctggaacatctgccttagaagtgcttcgaagggcaaccatc
aagaggagccggacagaggccatgacccgagactccagcgatgagcactgtgttgatatc
tcctctgtgggcacacctctggcccgagccagtatcaaaagtgcaaaggtagatggggtc
tcttatttccggcacaaggaaaggcttctgcgcatctccattcgccacatggttaaatcc
caggtgttttactggattgtgctgagccttgtagcactcaacactgcctgtgtggccatt
gtccatcacaaccagccccagtggctcacccacctcctctactatgcagaatttctgttt
ctgggactcttcctcttggagatgtccctgaagatgtatggcatggggcctcgcctttat
tttcactcttcattcaactgctttgattttggggtcacagtgggcagtatctttgaagtg
gtctgggcaatcttcagacctggtacgtcttttggaatcagtgtcttgcgagccctccgg
cttctaagaatatttaaaataaccaagtattgggcttccctgcggaatttggtggtctcc
ttgatgagctcgatgaagtctatcatcagtttacttttcctcctcttcctcttcattgtt
gtctttgctctcctaggaatgcagttatttggtggcaggtttaactttaatgatgggact
ccttcggcaaattttgacaccttccctgcagccatcatgaccgtgttccagatcctgacg
ggtgaggactggaatgaggtgatgtacaatgggatccgctcccagggcggggtcagctca
ggcatgtggtctgccatctacttcattgtgcttaccttgtttggcaactacacgctactg
aatgtgttcttggctattgctgtagataatctagccaacgcccaggagctgaccaaggat
gaacaggaggaggaagaggccttcaaccagaaacatgcactgcagaaggccaaggaggtc
agcccgatgtctgcacccaacatgccttcgatcgaaagagacagaaggagaagacaccac
atgtcgatgtgggagccacgcagcagccacctgagggagcggaggcgccggcaccacatg
tctgtgtgggagcagcgcaccagccagctgaggaagcacatgcagatgtccagccaggag
gccctcaacagggaggaggcgccgtccatgaacccgctcaacccactcagctccctcaac
ccactcaacacccactccagcctttatcggagacccagggccatcgagggcctggccctg
ggcctggccctggagaagttcgaggaggagcgcatcagccgtggggggtccctcaagggg
gatggaggtgaccgatccagtgccctggacaaccagaggacccccttgtccctgggccag
cgggagccgccgtggctggccaggccctgtcatgggaactgtgacccgactcagcaggag
gcggggggaggagaggctgtggtgacctttgaggaccgggccaggcacaggcagagccag
cggcgcagccggcatcgccgcgtcaggacggaaggcaaggagtcctcctcagcctctcgg
agcaggtctgctagccaggaacgcagtctggatgaagccatgcccactgaaggggagaag
gaccctgagctcaggggcaaccatggtgccaaggagccaacgatccaagaagagagagcc
caggatttaaggaggaccaacagtctgatggtgtccagaggctccgggctggcaggaggc
cttgatgaggctaatgcccccttagtcctgccccatcctgagctggaagtggggaaggac
atggtgccgacggagcaggagccggaaggtagcagtgagcaggccctgctgggggatgtg
cagctagacatgggccgggtcatcagccagagtgagcccgacctctcctgcatcacggcc
aacacggacaaggccaccaccgagagcaccagcgtcaccgtcgccatccccgacgtgggc
cccttggtggactcaactgtggtgcacattagcaacaagacggatggggaagccagtccc
ttgaaggaggcagagatcagagaggatgatgaggaggtggagaataaaaagcagaagaag
gagaagcgtgagacaggcaaagccatggtgcctcacagctcaatgttcatcttcagcacc
accaacccgatccggagggcctgccactacatcgtgaacctgcgctactttgagatgtgc
atcctcctggtgattgcagccagcagcatcgccctggcagcagaggaccccgtcctgacc
aactcagagcgcaacaaagtcctgaggtattttgactatgtgttcacgggcgtgttcacc
tttgagatggttataaagatgatagaccaaggcttgatcctgcaggatgggtcctacttc
cgagacctgtggaacatcctggactttgtggtggtcgttggcgcattggtggcctttgct
ctggcgaacgctttgggaaccaacaaaggacgggacatcaagaccatcaagtctctgcgg
gtgctccgagttctaaggccactgaaaaccatcaagcgcttgcccaagctcaaggctgtc
ttcgactgcgtggtgacctccttgaagaatgtcttcaacatacttattgtctacaagctc
ttcatgttcatctttgctgtcatcgcagttcagctcttcaagggaaagttcttttattgc
acggacagttccaaggacacagagaaggagtgcataggcaactatgtagatcatgagaaa
aacaagatggaggtgaagggccgggaatggaagcgccatgaattccactacgacaacatt
atctgggccctgctgaccctcttcaccgtctccacgggggaaggatggcctcaagttctg
cagcactctgtagatgtgacagaggaagaccgaggcccaagccgcagcaaccgcatggag
atgtctatcttttatgtggtctactttgtggtcttccctttcttctttgtcaatatcttt
gtggctctcatcatcatcaccttccaggagcaaggggataagatgatggaggagtgcagc
ctggagaagaatgagagggcgtgcatcgacttcgccatcagcgccaaacctctcacccgc
tacatgccgcagaacaggcacaccttccagtaccgcgtgtggcactttgtggtgtctccg
tccttcgaatacaccattatggccatgatcgccttgaataccgtcgtgctgatgatgaag
tattactctgctccctgtacctatgagctggccctgaagtatctgaatatcgccttcacc
atggtgttttccctggaatgcgtcctgaaggtcatcgcttttggctttttgaactatttc
cgagacacctggaatatctttgacttcatcactgtgattggcagtataacagaaattatc
ctgacagacagcaagctggtgaacaccagtggcttcaatatgagctttctgaagctcttc
cgagctgcccgcctcataaagcttctgcgtcagggctataccatacgcattttgctgtgg
acctttgtgcagtcctttaaggccctcccttacgtctgccttttaattgccatgcttttc
ttcatttatgccatcattgggatgcaggtatttggaaacataaaattagatgaggagagt
cacatcaaccggcacaacaacttccggagtttctttgggtccctaatgctactcttcagg
agtgccacaggtgaggcctggcaggagattatgctgtcatgcctcggggagaagggctgt
gagcctgacaccaccgcaccatcagggcagaacgagaacgagcgctgcggcaccgatctg
gcctacgtgtactttgtctccttcatcttcttctgctccttcttgatgctcaacctgttc
gtggccgtcatcatggacaactttgagtacctgactcgggactcctccatcctggggcct
caccacttggacgagtttgtccgcgtctgggcagaatatgaccgagcagcatgtggccgc
atccattacactgagatgtatgaaatgctgactctcatgtcacctccgctaggcctcggc
aagagatgtccctccaaagtggcatataagaggttggtcctgatgaacatgccagtagct
gaggacatgacggtccacttcacctccacacttatggctttgatccggacagctctggac
attaaaattgccaaaggtggtgcagacaggcagcagctagactctgagctacaaaaggag
accctagccatctggcctcacctatcccagaagatgctggatctgcttgtgcccatgccc
aaagcctctgacctgactgtgggcaaaatctatgcagcaatgatgatcatggactactat
aagcagagtaaggtgaagaagcagaggcagcagctggaggaacagaaaaatgcccccatg
ttccaacgcatggagccctcatctctgcctcaggagatcatcgctaatgccaaagccctg
ccttacctccagcaggaccccgtttcaggcctgagtggccggagtggatacccttcgatg
agtccactctctccccaggagatattccagttggcttgtatggaccccgccgatgatgga
cagttccaggaacagcagtctctggagccagaggttagtgaattaaaaagcgtgcagccc
tctaaccatggcatctaccttccttcggacacccaggagcatgcgggatctgggagggca
tcctctatgccacgtctgactgtggatccccaggtggtgacagaccctagctccatgaga
cgttcattttccactattcgggataagcgttcaaattcctcgtggttggaggaattctcc
atggagcgaagcagtgaaaatacctacaagtcccgtcgccggagttaccactcctccttg
cggctgtcagcccaccgcctgaactctgattcaggccacaagtctgacactcaccgctca
gggggcagggagcgaggacgatcaaaagagcgaaagcatcttctctctcctgatgtctcc
cgctgcaattcagaagagcgagggacccaggctgactgggagtccccagagcgccgtcaa
tccaggtcacccagtgagggcaggtcacagacgcccaacagacagggcacaggttcccta
agtgagagctccatcccctctgtctctgacaccagcaccccaagaagaagtcgtcggcag
ctcccgcccatcccaccaaagccccggcccctcctttcctacagctccctgattcgacac
gtgggcagcatctctccacctgctgacggaagcgaggagggctccccactgacctcccaa
gcgctggagaacaacaacacttgcctgaccgagtcttccaactccccgcacccccggcag
ggccaacatgcctccccacagcgctacatctccgagccctacttggccctgcacgaagac
tcccacgcctcagactgtggcgaggaggagacgctcacttttgaagcagccgtggctact
agcctgggccgttccaacaccatcggctcagccccacccctgcggcacagctggcagatg
cccaatgggcactatcggcgacggaggcgcggggggcctgggccaggcatgatgtgtggg
gctgtcaacaacctgctaagtgacacggaagaagatgacaaatgctag

DBGET integrated database retrieval system