KEGG   Macaca mulatta (rhesus monkey): 718225Help
Entry
718225            CDS       T01028                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05034  Alcoholism
mcc05165  Human papillomavirus infection
mcc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    718225 (HDAC7)
  09164 Substance dependence
   05034 Alcoholism
    718225 (HDAC7)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    718225 (HDAC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcc03036]
    718225 (HDAC7)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     718225 (HDAC7)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     718225 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 718225
NCBI-ProteinID: XP_015007020
Ensembl: ENSMMUG00000021655
LinkDB All DBs
Position
11
AA seq 1016 aa AA seqDB search
MHSPGADGTQVSPGAHYRSPTGTGYFPRHFRRDTDLFIDSMFVECLSCGCPRPCADTPGP
QPQPMDLRVGQRPPVEPPPEPTLLALQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPE
LQVGPQEQELRQLLHKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHSNSPGIPYRT
LEPLETEGAARSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPL
LRKESAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHGPNPILGSEALLGQRLRLQ
ETSLAPFALPTVSLLPAITLGLPAPARADSDRRTHPTLGPRGPILGSPHTPLFLPHGLEP
EAGGTLPSRLQPILLLDPSGSHAPLLTVPGLGPLPFHFAQSLMTTERLSGSGLHWPLSRT
RSEPLPPSATAPPPPGPMQPRLEQLKTHVQVIKRSAKPSEKPRLRQIPSAEDLETDGGGP
GQVVDDGLEHRELSHGQPEARGPAPLQQHPQVLLWEQQRLAGRLPRGSTGDTVLLPLAQG
GHRPLSRAQSSPAAPASLSAPEPASQARVLSSSETPARTLPFTTGLIYDSVMLKHQCSCG
DNSRHPEHAGRIQSIWSRLQERGLRSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSR
LKLDNGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRE
LKNGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQSKASKILIVDWDVHHGNGTQQ
TFYQDPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWTGGLDPPMGDPEYLA
AFRTVVMPIAREFSPDLVLVSAGFDAAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVV
LALEGGHDLTAICDASEACVAALLGNKVDPLSEEGWKQKPNLNAIRSLEAVIRVHSKYWG
CMQRLASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atgcacagccccggcgctgatgggacccaggtgagcccgggtgcccactatcgcagcccc
actggcacagggtactttcctcgacattttaggagagacaccgatttattcattgattct
atgtttgtggagtgcctgtcatgtggctgccccaggccctgtgcagacacaccaggccct
cagccccagcccatggacctgcgggtgggccagcggcccccagtggagcccccaccagag
cccacattgctggccctgcagcgtccccagcgcctgcaccaccacctcttcctagcaggc
ctgcagcagcagcgctcggtggagcccatgaggctctccatggacacaccgatgcccgag
ttgcaggtgggaccccaggaacaagagttgcggcagcttctccacaaggacaagagcaag
cgaagtgctgtagccagcagcgtggtcaagcagaagctggcagaggtgattctgaaaaaa
cagcaggcagccctagagagaacagtccattccaacagccccggcattccctacagaacc
ctggagcccctggagacggaaggagccgcccgctccatgctcagcagctttttgcctcct
gttcccagcctgcccagtgaccccccagagcacttccctctgcgcaagacagtctctgag
cccaacctgaagctgcgctataagcccaagaagtccctggagcggaggaagaatccactg
ctccgaaaggaaagtgcgccccccagcctccggcggcggcctgcagagaccctcggagac
tcctccccaagtagtagcagcacgcctgcgtcagggtgcagctcccccaatgacagcgag
cacggccccaatcccatcctgggctcggaggcgctcttgggccagcggctgcggctgcag
gagacttctctggccccgttcgccttgccgacagtgtccttgctgcccgcaatcacgctg
gggctgcccgcccctgccagggctgacagtgaccgcaggacccatccgactctgggccct
cgggggccgatcctggggagcccccacactcccctcttcctgccccatggcctggagccc
gaggctgggggcactttgccctctcgcctgcagcccattctcctcctggacccctcaggc
tctcatgccccgctgctgactgtgcccgggcttgggcccttgcccttccactttgcccag
tccttaatgaccaccgagcggctctccgggtcaggtctccactggccactgagccggact
cgctcagagcccctgccccccagtgccaccgctcccccaccgccgggccccatgcagccc
cgcctggagcaactcaaaactcacgtccaggtgatcaagaggtcagccaaaccgagtgag
aagccccggctgcggcagataccttcggctgaagacctggagacagatggtgggggaccg
ggccaggtggtagacgatggcctggaacacagggagctgagccatgggcagcctgaggcc
agaggccctgctcctctccagcagcacccccaggtgttgctctgggaacagcagcgactg
gctgggcggctcccccggggcagcaccggggacactgtgctgcttcctctggctcagggt
gggcaccggcctctgtcccgggctcagtcttccccagccgcacctgcctcactgtcagcc
ccagaacctgccagccaggcgcgagtcctctccagctcagagacccctgccaggaccctg
cccttcaccacagggctgatctatgactcggtcatgctgaagcaccagtgctcctgtggt
gacaacagcaggcacccagagcacgccggccgcatccagagcatctggtcccggctgcag
gagcggggtctccggagccagtgtgagtgtctccgaggccggaaggcctccctggaggag
ctgcagtcggtccactctgagcggcacgtgctcctctatggcaccaacccgctcagccgc
ctcaaactggacaacgggaagctggcagggctcctggcacagcggatgtttgtgatgctg
ccctgtggtggggttggggtggacactgacaccatctggaatgagctgcattcctccaat
gcagcccgctgggccgctggcagtgtcactgacctcgccttcaaagtggcttctcgtgag
ctgaagaatggtttcgctgtggtgcggcccccaggacaccatgcagatcattcaacagcc
atgggcttctgcttcttcaactcagtggccatcgcctgccggcagctgcaacagcagagc
aaggctagcaagatcctcattgtagactgggacgtgcaccatggcaacggcacccagcaa
accttctaccaagaccccagtgtgctctacatctccctgcatcgccatgacgatggcaac
ttcttcccggggagtggggctgtggatgaggtaggggctggcagcggtgagggcttcaat
gtcaatgtggcctggactggaggtctggatccccccatgggggatcctgagtacctggct
gctttcaggacagtcgtgatgcccattgcccgagagttctctccagacctagtcctggtg
tctgctggatttgatgctgctgagggtcacccggccccactgggtggctaccatgtttct
gccaaatgttttgggtacatgacgcagcaactgatgaacctggcaggaggtgcagtggtg
ctggccttggagggtggccatgacctcacagccatctgtgacgcctctgaggcctgtgtg
gctgctcttctgggtaacaaggtggatcccctttcagaagaaggctggaaacagaaaccc
aacctcaatgccatccgctctctggaggccgtgatccgggtgcacagtaaatactggggc
tgcatgcagcgcctggcctcctgtccagactcctgggtgcctagagtgccaggggctgac
aaagaagaagtggaggcagtgaccgcactggcatccctctctgtgggcatcctggctgaa
gacaggccctcggagcagctggtggaggaggaagaacctatgaatctctaa

DBGET integrated database retrieval system