KEGG   Macaca mulatta (rhesus monkey): 718284
Entry
718284            CDS       T01028                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc01524  Platinum drug resistance
mcc04068  FoxO signaling pathway
mcc04110  Cell cycle
mcc04115  p53 signaling pathway
mcc04120  Ubiquitin mediated proteolysis
mcc04144  Endocytosis
mcc04151  PI3K-Akt signaling pathway
mcc04218  Cellular senescence
mcc04625  C-type lectin receptor signaling pathway
mcc04919  Thyroid hormone signaling pathway
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05203  Viral carcinogenesis
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    718284 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    718284 (MDM2)
   04151 PI3K-Akt signaling pathway
    718284 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    718284 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    718284 (MDM2)
   04115 p53 signaling pathway
    718284 (MDM2)
   04218 Cellular senescence
    718284 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    718284 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    718284 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    718284 (MDM2)
   05202 Transcriptional misregulation in cancer
    718284 (MDM2)
   05206 MicroRNAs in cancer
    718284 (MDM2)
   05205 Proteoglycans in cancer
    718284 (MDM2)
   05203 Viral carcinogenesis
    718284 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    718284 (MDM2)
   05220 Chronic myeloid leukemia
    718284 (MDM2)
   05218 Melanoma
    718284 (MDM2)
   05219 Bladder cancer
    718284 (MDM2)
   05215 Prostate cancer
    718284 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    718284 (MDM2)
   05169 Epstein-Barr virus infection
    718284 (MDM2)
   05165 Human papillomavirus infection
    718284 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    718284 (MDM2)
   01522 Endocrine resistance
    718284 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    718284 (MDM2)
   04121 Ubiquitin system [BR:mcc04121]
    718284 (MDM2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     718284 (MDM2)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    718284 (MDM2)
Ubiquitin system [BR:mcc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    718284 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 718284
NCBI-ProteinID: NP_001253331
Ensembl: ENSMMUG00000014193
UniProt: H9FUJ1
LinkDB
Position
11
AA seq 497 aa
MVRSRQMCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVL
FYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQE
SSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDE
LSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGD
WLDQDSVSDQFSVEFEVESLDSEDYSLSEEAQELSDEDDEVYRVTVYQAGESDTDSFEED
PEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAE
EGFDVPDCKKTIVNDSKESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEF
EREETQDKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKP
CPVCRQPIQMIVLTYFP
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggtgaggagcaggcaaatgtgcaataccaacatgtctgtacctactgatggtgctgta
accacctcacagattccagcttctgaacaagagaccctggttagaccaaagccattgctt
ttgaagttattaaagtctgttggtgcacaaaaagacacttacactatgaaagaggttctt
ttttatcttggccagtatattatgactaaacgattatatgatgagaagcaacaacatatt
gtatattgttcaaatgatcttctaggagatttgtttggtgtgccaagcttctctgtgaaa
gagcacaggaaaatatataccatgatctacagaaacttggtagtagtcaatcagcaggaa
tcatcagactcaggtacatctgtgagtgagaacaggtgtcaccttgaaggtgggagtgat
caaaaggaccttgtgcaagagcttcaggaagagaaaccttcgtcttcacatttggtttct
agaccatctacctcatctagaaggagagcgattagtgagacagaagaaaattcagatgaa
ttatctggtgaacgacaaagaaaacgccacaaatctgatagtatttccctttcctttgat
gaaagcctggctctgtgtgtaataagggagatatgttgtgaaagaagcagtagcagtgaa
tctacagggacgccgtcgaatccggatcttgatgctggtgtaagtgaacattcaggtgat
tggttggatcaggattcagtttcagatcagtttagtgtagaatttgaagttgaatctctc
gactcagaagattatagccttagtgaagaagcacaagaactctcagatgaagatgatgag
gtatatcgagttactgtgtatcaggcaggggagagtgatacagattcatttgaagaagat
cctgaaatttccttagctgactattggaaatgcacttcatgcaatgaaatgaatccccct
cttccatcacattgcaacagatgttgggcccttcgtgagaattggcttcctgaagataaa
gggaaagataaaggggaaatctctgagaaagccaaactggaaaactcaacacaagctgaa
gagggctttgatgttcctgattgtaaaaaaactatagtgaatgattccaaagagtcgtgt
gttgaggaaaatgatgataaaatcacacaagcctcacaatcacaagaaagtgaggactat
tctcagccatcaacttctagtagcattatttatagcagccaagaagacgtgaaagagttt
gaaagggaagaaacacaagacaaagaagaaagtgtggaatctagtttgccccttaatgcc
attgaaccttgtgtgatttgtcagggtcgacctaaaaatggttgcattgtccatggcaaa
acaggacatcttatggcctgctttacatgtgcaaagaagctaaagaaaaggaataagccc
tgcccagtgtgtagacaaccaattcaaatgattgtgctaacttatttcccctag

DBGET integrated database retrieval system