KEGG   Macaca mulatta (rhesus monkey): 718528Help
Entry
718528            CDS       T01028                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03030  DNA replication
mcc03410  Base excision repair
mcc03420  Nucleotide excision repair
mcc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    718528 (LIG1)
   03410 Base excision repair
    718528 (LIG1)
   03420 Nucleotide excision repair
    718528 (LIG1)
   03430 Mismatch repair
    718528 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mcc03032]
    718528 (LIG1)
   03400 DNA repair and recombination proteins [BR:mcc03400]
    718528 (LIG1)
Enzymes [BR:mcc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     718528 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     718528 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     718528 (LIG1)
DNA replication proteins [BR:mcc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    718528 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     718528 (LIG1)
DNA repair and recombination proteins [BR:mcc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     718528 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     718528 (LIG1)
   MMR (mismatch exicision repair)
    Other MMR factors
     718528 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DUF1685
Motif
Other DBs
NCBI-GeneID: 718528
NCBI-ProteinID: XP_001111346
Ensembl: ENSMMUG00000014591
LinkDB All DBs
Position
19
AA seq 919 aa AA seqDB search
MQRSIMSFFHPKKEGKAKKPEKEASNGSRETEPPPKAALKEWNGVVSESDSPVKRPGRKA
ARVLGSEGEEEDEALSPAKGQKPAPDCSQVSPPRPATSPENNASLSDTSPTDSSPSGIPK
RRTARKQLPKRTIQEVLEEQSADEDREAKRKKVEEEVETPEESLTEAEVATEKEGEDRDQ
PTTPPKPLKTSKAETLTESVSEPEVATRQELQEEEEQTKPPRSAPKTLSSFFTPRKPAIK
KEVKEEEPGAPGKEGAAEGPLDPSGYNPAKNNYHPVEDACWKPGQKVPYLAVARTFEKIE
EVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVGDGVLLKAVAQ
ATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSKFRDIARLTGSAST
AKKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAGQSVLAALSQAVSLTPPGQEFPPAV
VDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGIPL
KPMLAHPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPD
IISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF
DLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDVEQIAEFLEQSVKDSCE
GLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLL
ASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVTPDHWLDPSA
VWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQ
SQIQNQQGEDSGSDPEDTY
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatcatgtcattcttccaccccaagaaagagggtaaagcgaagaagcct
gagaaggaggcatccaacggcagcagagagacggagccccctccgaaggcggcactgaag
gagtggaatggagtggtgtccgagagtgactctccagtgaagaggccaggcaggaaggcg
gcccgggtcctgggcagcgaaggggaagaggaggatgaagcccttagccctgctaaaggc
cagaagcctgccccggactgctcacaggtctccccgccccgtcctgccacatctcctgaa
aacaacgcttccctctctgacacctctcccacggacagctccccatcagggatcccgaag
cgtcgcacagctcggaagcagctcccgaaacggaccattcaggaagtcctggaagagcag
agtgcggacgaggacagagaagccaaaaggaagaaggtggaggaagaagtggagacccca
gaagaaagcctcacagaggctgaagtggcaacagagaaggaaggagaagacagggaccag
cccaccacacctcccaagcccctaaagacctccaaagcagagaccctgacggaaagcgtt
tcggagcccgaggtggccacgaggcaggaactgcaggaggaggaagagcagaccaagcct
ccccgcagcgctcccaagacgctcagcagcttcttcacgccccggaagccagcaatcaaa
aaagaagtgaaggaggaggagccaggggctccaggaaaggagggagctgctgagggaccc
ctggacccatccggttacaatcctgccaagaacaactaccatcccgtggaagacgcctgc
tggaaaccgggccagaaggtcccttacctggccgtggcccggacgtttgagaagatcgag
gaggtgtctgcccggctccggatggtggagacactgagcaacttgctgcgctccgtggtg
gccctgtcgcctccagacctcctcccagtcctctacctcagcctcaaccaccttgggcca
ccgcagcagggcctggagcttggcgtgggtgatggcgtccttctcaaggcagtggcccag
gccacaggtcggcagctggagtctgtccgggctgaggcagccgagaagggcgacgtgggg
ctggtggccgagaacagccgcagcacccagaggctcatgctgccaccacctccgctcact
gcttccggggtcttcagcaagttccgtgacatcgccaggctcactggcagtgcttccaca
gccaagaagatagacatcatcaaaggcctctttgtggcctgccgccactcagaagcccgg
ttcatcgccaggtccctgagcggacggctgcgccttgggctggcagggcagtcggtgctg
gccgccctctcccaggctgtgagcctcacgcccccaggccaagaattcccaccagccgtg
gtagatgctgggaagggcaagacagcagaggccagaaagacgtggctggaggagcaaggc
atgatcctgaagcagacattctgcgaggtgcccgatctggaccgaattatccccgtgctg
ctggagcacggcctggaacgtctcccggagcactgcaagctgagcccagggattcccctg
aaaccaatgttggcccatcccacgcggggcgtcagtgaggtcctgaaacgctttgaggag
gcagctttcacctgcgaatacaaatacgatgggcagagggcacagatccacgccctggaa
ggcggggaggtgaagatcttcagcaggaatcaggaagacaacactggaaagtacccggac
atcatcagccgcatccccaagattaaactcccatcggtcacatccttcatcctggacact
gaagccgtggcttgggaccgggaaaagaagcagatccagccattccaagtgctcaccacc
cgcaaacgcaaggaagtggatgcgtccgagatccaggtgcaggtgtgtttgtacgccttc
gacctcatctacctcaatggagagtccctggtacgtgagcccctttcccggcgccggcag
ctgctccgggagaactttgtggagacggagggcgagtttgtcttcgccacctctctggac
accaaggacgtcgagcagatcgccgagttcctggagcagtcagtgaaagactcctgcgag
gggctgatggtgaagaccctggatgtcgatgccacctacgagatcgccaagagatcgcac
aactggctcaagctgaagaaggactaccttgacggcgtgggtgacaccctggacctggtg
gtgatcggcgcctacctgggccgggggaagcgggccggccggtacgggggcttcctgctg
gcctcctacgacgaggacagtgaggagctgcaggccatatgcaagcttggaactggcttc
agcgacgaggagctggaggagcatcaccagagcctcaaggccctggtgctgcccagcccc
cgcccttatgtgcggatagatggtgccgtgactcccgaccactggctggaccccagcgcc
gtgtgggaggtgaagtgtgccgacctctccctctcccccatctaccctgctgcgcggggc
ctggtggatagtgacaaggggatctcccttcgcttccctcggtttattcgagtccgtgaa
gacaagcagccggagcaggccaccaccagtgcacaggtggcctgtttgtaccggaagcaa
agtcagattcagaaccaacaaggcgaggactcaggctctgaccctgaagatacctactaa

DBGET integrated database retrieval system