KEGG   Macaca mulatta (rhesus monkey): 718948
Entry
718948            CDS       T01028                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX
  KO
K02159  apoptosis regulator BAX
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc01524  Platinum drug resistance
mcc04071  Sphingolipid signaling pathway
mcc04115  p53 signaling pathway
mcc04141  Protein processing in endoplasmic reticulum
mcc04210  Apoptosis
mcc04211  Longevity regulating pathway
mcc04215  Apoptosis - multiple species
mcc04217  Necroptosis
mcc04722  Neurotrophin signaling pathway
mcc04932  Non-alcoholic fatty liver disease
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc05012  Parkinson disease
mcc05014  Amyotrophic lateral sclerosis
mcc05016  Huntington disease
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05132  Salmonella infection
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05203  Viral carcinogenesis
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05216  Thyroid cancer
mcc05217  Basal cell carcinoma
mcc05218  Melanoma
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    718948 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    718948 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    718948 (BAX)
   04215 Apoptosis - multiple species
    718948 (BAX)
   04217 Necroptosis
    718948 (BAX)
   04115 p53 signaling pathway
    718948 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    718948 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    718948 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    718948 (BAX)
   05202 Transcriptional misregulation in cancer
    718948 (BAX)
   05203 Viral carcinogenesis
    718948 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    718948 (BAX)
   05212 Pancreatic cancer
    718948 (BAX)
   05225 Hepatocellular carcinoma
    718948 (BAX)
   05226 Gastric cancer
    718948 (BAX)
   05214 Glioma
    718948 (BAX)
   05216 Thyroid cancer
    718948 (BAX)
   05220 Chronic myeloid leukemia
    718948 (BAX)
   05217 Basal cell carcinoma
    718948 (BAX)
   05218 Melanoma
    718948 (BAX)
   05213 Endometrial cancer
    718948 (BAX)
   05224 Breast cancer
    718948 (BAX)
   05222 Small cell lung cancer
    718948 (BAX)
   05223 Non-small cell lung cancer
    718948 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    718948 (BAX)
   05014 Amyotrophic lateral sclerosis
    718948 (BAX)
   05016 Huntington disease
    718948 (BAX)
   05020 Prion disease
    718948 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    718948 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    718948 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    718948 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    718948 (BAX)
   05152 Tuberculosis
    718948 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    718948 (BAX)
   05170 Human immunodeficiency virus 1 infection
    718948 (BAX)
   05161 Hepatitis B
    718948 (BAX)
   05160 Hepatitis C
    718948 (BAX)
   05164 Influenza A
    718948 (BAX)
   05162 Measles
    718948 (BAX)
   05168 Herpes simplex virus 1 infection
    718948 (BAX)
   05163 Human cytomegalovirus infection
    718948 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    718948 (BAX)
   05169 Epstein-Barr virus infection
    718948 (BAX)
   05165 Human papillomavirus infection
    718948 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    718948 (BAX)
   01524 Platinum drug resistance
    718948 (BAX)
   01522 Endocrine resistance
    718948 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mcc03029]
    718948 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcc02000]
    718948 (BAX)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    718948 (BAX)
Transporters [BR:mcc02000]
 Other transporters
  Pores ion channels [TC:1]
   718948 (BAX)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 718948
NCBI-ProteinID: NP_001247945
Ensembl: ENSMMUG00000003907
UniProt: F6ZV78
LinkDB
Position
19
AA seq 192 aa
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELALDPVPQDASTKRLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTILVAGV
LTASLTIWKKMG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcagcccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatggggggg
gagacacccgagctggccctggacccggtgcctcaggatgcgtccaccaagaggctgagc
gagtgtctcaagcgcatcggggacgaactggacagtaacatggagctgcagaggatgatt
gccgccgtggacacagactccccccgagaggtctttttccgagtggcagctgacatgttt
tctgacggcaacttcaactggggccgtgttgtcgcccttttctactttgccagcaaactg
gtgctcaaggccctgtgtaccaaggtgcccgaactgatcagaaccatcatgggctggacg
ctggacttcctccgggagcggctgttgggctggatccaagaccagggtggttgggacggc
ctcctctcctactttgggacgcccacgtggcagaccgtgaccatcttggtggctggagta
ctcaccgcctccctcaccatctggaagaagatgggctga

DBGET integrated database retrieval system