KEGG   Macaca mulatta (rhesus monkey): 718970
Entry
718970            CDS       T01028                                 

Gene name
IRF3
Definition
(RefSeq) interferon regulatory factor 3
  KO
K05411  interferon regulatory factor 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
mcc05133  Pertussis
mcc05135  Yersinia infection
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    718970 (IRF3)
   04621 NOD-like receptor signaling pathway
    718970 (IRF3)
   04622 RIG-I-like receptor signaling pathway
    718970 (IRF3)
   04623 Cytosolic DNA-sensing pathway
    718970 (IRF3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    718970 (IRF3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    718970 (IRF3)
   05133 Pertussis
    718970 (IRF3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    718970 (IRF3)
   05161 Hepatitis B
    718970 (IRF3)
   05160 Hepatitis C
    718970 (IRF3)
   05171 Coronavirus disease - COVID-19
    718970 (IRF3)
   05164 Influenza A
    718970 (IRF3)
   05162 Measles
    718970 (IRF3)
   05168 Herpes simplex virus 1 infection
    718970 (IRF3)
   05163 Human cytomegalovirus infection
    718970 (IRF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    718970 (IRF3)
   05169 Epstein-Barr virus infection
    718970 (IRF3)
   05165 Human papillomavirus infection
    718970 (IRF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcc03000]
    718970 (IRF3)
   04131 Membrane trafficking [BR:mcc04131]
    718970 (IRF3)
Transcription factors [BR:mcc03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    718970 (IRF3)
Membrane trafficking [BR:mcc04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    718970 (IRF3)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 718970
NCBI-ProteinID: NP_001129269
Ensembl: ENSMMUG00000022735
UniProt: B6CJX6
LinkDB
Position
19
AA seq 422 aa
MGTPKPRILPWLVSQLDLGQLEGVAWVNESRTRFRIPWKHGLRQDAQEEDFRIFQAWAEA
TGAYVPGRDKPDLPTWKRNFRSALNRKDGLCLAEDRSKDPHDPHKIYEFVNSGVGDFSQP
DSSPDTNGGGSTSDTQENILDELLGNMVLAPLPDPGPPSLAVAPQHLQSPSLDSPTPFPN
LEPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPIT
LPDPGMSLTDRGVMSYVRHVLSSLGGGLALRRAGQRLWAQRLGHCHTYWAVSEELLNSGH
GPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMV
KVVPTCLRALVEIARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEDMDFQGPG
ET
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgggaaccccaaagccacggatcctgccctggctggtgtcgcagctggacctggggcaa
ctggagggcgtggcctgggtgaacgagagccgcacgcgcttccgcatcccttggaagcac
ggcctacggcaggatgcacaggaggaggatttcagaatcttccaggcctgggccgaggcc
actggtgcgtacgttcccgggagggataagccagacctgccaacctggaagaggaatttc
cgttctgccctcaaccgcaaagatgggttgtgtttagcagaggaccggagcaaggaccct
cacgacccacataagatctacgagtttgtgaactcaggagttggggacttttcccagcca
gactcctctccggacaccaatggcggaggcagtacttctgatacccaggaaaacattctg
gatgagttactgggtaacatggtgttggccccactgccagatccaggacccccaagcctg
gctgtagcccctcagcacttgcagagccccagcttggacagtcccactcccttcccaaac
ctggagccctctgagaacccactgaagcggctgttggtgccgggggaagagtgggagttc
gaggtgacagccttctaccggggccgccaagtcttccagcagaccatctcctgcccggag
ggcctgcggctggtggggtccgaagtgggcgacaggacgctgcctggatggccaatcaca
ctgccagaccctggcatgtccctgacagacaggggagtgatgagctacgtgaggcacgtg
ctgagctccctgggtgggggactggctctgcggcgggccgggcagcggctctgggcccag
cggctggggcactgccacacatactgggcagtgagcgaggagctgctcaacagcgggcat
gggcctgatggcgaggtccccaaggacaaggaaggaggcgtgttcgacctggggcccttc
attgtagatctgatcaccttcacagaaggaagtggacgctcaccacgctatgccctctgg
ttctgtgtgggggagtcatggccccaggaccagccatggaccaagaggctcgtgatggtc
aaggttgtgcccacgtgcctcagggccctggtagaaatcgcccgggtagggggtgcctcc
tccctggagaacactgtggacctgcacatttccaacagccacccactgtccctcacctct
gaccagtacaaggcctacctgcaggacctggtggaggatatggatttccagggccctggg
gagacctga

DBGET integrated database retrieval system