KEGG   Macaca mulatta (rhesus monkey): 719199
Entry
719199            CDS       T01028                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc01524  Platinum drug resistance
mcc04012  ErbB signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04110  Cell cycle
mcc04115  p53 signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04218  Cellular senescence
mcc04630  JAK-STAT signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
mcc05203  Viral carcinogenesis
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05211  Renal cell carcinoma
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05216  Thyroid cancer
mcc05217  Basal cell carcinoma
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    719199 (CDKN1A)
   04630 JAK-STAT signaling pathway
    719199 (CDKN1A)
   04066 HIF-1 signaling pathway
    719199 (CDKN1A)
   04068 FoxO signaling pathway
    719199 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    719199 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    719199 (CDKN1A)
   04115 p53 signaling pathway
    719199 (CDKN1A)
   04218 Cellular senescence
    719199 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    719199 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    719199 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    719199 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    719199 (CDKN1A)
   05206 MicroRNAs in cancer
    719199 (CDKN1A)
   05205 Proteoglycans in cancer
    719199 (CDKN1A)
   05203 Viral carcinogenesis
    719199 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    719199 (CDKN1A)
   05212 Pancreatic cancer
    719199 (CDKN1A)
   05225 Hepatocellular carcinoma
    719199 (CDKN1A)
   05226 Gastric cancer
    719199 (CDKN1A)
   05214 Glioma
    719199 (CDKN1A)
   05216 Thyroid cancer
    719199 (CDKN1A)
   05220 Chronic myeloid leukemia
    719199 (CDKN1A)
   05217 Basal cell carcinoma
    719199 (CDKN1A)
   05218 Melanoma
    719199 (CDKN1A)
   05211 Renal cell carcinoma
    719199 (CDKN1A)
   05219 Bladder cancer
    719199 (CDKN1A)
   05215 Prostate cancer
    719199 (CDKN1A)
   05213 Endometrial cancer
    719199 (CDKN1A)
   05224 Breast cancer
    719199 (CDKN1A)
   05222 Small cell lung cancer
    719199 (CDKN1A)
   05223 Non-small cell lung cancer
    719199 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    719199 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    719199 (CDKN1A)
   05161 Hepatitis B
    719199 (CDKN1A)
   05160 Hepatitis C
    719199 (CDKN1A)
   05163 Human cytomegalovirus infection
    719199 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    719199 (CDKN1A)
   05169 Epstein-Barr virus infection
    719199 (CDKN1A)
   05165 Human papillomavirus infection
    719199 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    719199 (CDKN1A)
   01522 Endocrine resistance
    719199 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 719199
NCBI-ProteinID: NP_001181651
Ensembl: ENSMMUG00000003210
UniProt: F7EEK4 G7MP60
LinkDB
Position
4
AA seq 164 aa
MSEQAGSVRPNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
PRSGEQPEESPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcagaacaggctggcagtgtccgtccgaacccatgcggcagcaaggcctgccgccgc
ctcttcggcccagtggacagcgagcagctgagccgcgactgtgatgcgctaatggcgggc
tgtatccaggaggcccgtgagcgatggaacttcgactttgtcaccgagacaccactggag
ggtgacttcgcctgggagcgtgtgcggggccttggcctgcccaagctctaccttcccaca
gggccccggcggggccgggatgagttgggaggaggcaggcggcctggcacctcacctgct
ctgctgcagggcacagcagaggaagaccatgtggacctgtcgctatcttgtacccttgtg
cctcgctcaggggagcagcctgaagagtccccaggtggacctggagactctcagggtcga
aaacggcggcagaccagcatgacagatttctaccactccaaacgccggctgatcttctcc
aagaggaagccctaa

DBGET integrated database retrieval system