KEGG   Macaca mulatta (rhesus monkey): 719260
Entry
719260            CDS       T01028                                 

Gene name
AIM2
Definition
(RefSeq) interferon-inducible protein AIM2 isoform X1
  KO
K12966  absent in melanoma 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04621  NOD-like receptor signaling pathway
mcc04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    719260 (AIM2)
   04623 Cytosolic DNA-sensing pathway
    719260 (AIM2)
SSDB
Motif
Pfam: HIN PYRIN tRNA_anti-codon
Other DBs
NCBI-GeneID: 719260
NCBI-ProteinID: XP_001117183
Ensembl: ENSMMUG00000004492
LinkDB
Position
1
AA seq 343 aa
MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNVATGKLRTANRIQVANLMIQNAGAVT
AVKKTILIFQKLNYMLLAKRLQEEKEKVDKKYKSITKPKPLSQPEMSPAAPAAVRNDVTK
QRAAPKVSPHVKPEQKQRVAQQESIREEFRKDCLPVMVLKATKPFTFETQEGKQEMFHAT
VATEKEFFFVKVFNTLLKDKFIPKRMIIISRYYQHSGFLEVNSASCVLDAKSDQKVDVPL
NIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNVLFDLSDKTGEMEVLAVRNED
TMQCKEGDKVRLTFFTLSKNGEKPQLTSGVHSTIKVIKASKKT
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggagagtaaatacaaggagatactcttgctaacaggcctggataacatcactgatgag
gaactggataggtttaagttctttctttcagacgagtttaatgtcgccacaggcaaacta
cgtactgcaaacagaatacaagtagctaacttgatgattcaaaatgctggtgcagtgact
gcagtgaagaagaccattcttatttttcagaagttgaattatatgcttttggcaaaacgt
cttcaggaagagaaggagaaagttgataagaaatacaaatcgataacaaaaccaaagcca
ctaagtcaacctgaaatgagtcctgctgcacctgcagccgtcagaaatgatgtcacaaag
caacgtgctgcaccaaaagtctctcctcatgttaagcctgagcagaaacagagggtggcc
cagcaggaatctatcagagaagagtttcggaaagactgtttgccagttatggtactgaaa
gcaacaaagcccttcacgtttgagacccaagaaggcaagcaagagatgtttcatgctacg
gtggctacagagaaggaattcttctttgtaaaagtttttaatacactgctgaaagataaa
ttcattccaaagagaatgattataatatcaagatattatcagcacagtggtttcttagag
gtaaatagcgcctcatgtgtgttagatgctaaatctgaccaaaaggttgatgtcccgctg
aacattatcagaaaagctggtgaaaccccaaagatcaacacgcttcaaactcagcccctt
ggaacaattgtgaatgggttgtttgtagtccagaaggtaacagaaaagaagaaaaatgta
ttatttgacctaagtgacaagactggggaaatggaagtattggcggttagaaacgaggac
acaatgcaatgtaaggaaggagataaggttcgacttacattcttcacactgtcaaaaaat
ggagaaaaaccgcagctgacatctggagttcatagcaccataaaggttattaaggccagt
aaaaaaacatag

DBGET integrated database retrieval system