KEGG   Macaca mulatta (rhesus monkey): 719444
Entry
719444            CDS       T01028                                 

Gene name
KLK3
Definition
(RefSeq) prostate-specific antigen precursor
  KO
K01351  semenogelase [EC:3.4.21.77]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc05200  Pathways in cancer
mcc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    719444 (KLK3)
  09162 Cancer: specific types
   05215 Prostate cancer
    719444 (KLK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcc01002]
    719444 (KLK3)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.77  semenogelase
     719444 (KLK3)
Peptidases and inhibitors [BR:mcc01002]
 Serine peptidases
  Family S1: chymotrypsin family
   719444 (KLK3)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 719444
NCBI-ProteinID: NP_001036241
Ensembl: ENSMMUG00000012841
UniProt: P33619 G7NMC9
LinkDB
Position
19
AA seq 261 aa
MWVLVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWV
LTAAHCIRSNSVILLGRHNPYYPEDTGQVFQVSHSFPHPLYNMSLLKNRYLGPGDDSSHD
LMLLRLSEPAEITDAVQVLDLPTWEPELGTTCYASGWGSIEPEEHLTPKKLQCVDLHIIS
NDVCAQVHSQKVTKFMLCAGSWMGGKSTCSGDSGGPLVCDGVLQGITSWGSQPCALPRRP
SLYTKVVRYRKWIQDTIMANP
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtgggttctggttgtcttcctcaccctgtccgtgacgtggattggcgctgcacccctc
atcctgtctcggattgtgggaggctgggagtgcgagaagcattcccaaccctggcaggtg
cttgtggcctctcgtggcagggcagtctgcgggggtgttctggtgcacccccagtgggtc
ctcacagctgcccactgcatcaggagcaacagcgtgatcttgctgggtcggcacaacccg
tattatcctgaagacacgggccaggtgtttcaggtcagccacagcttcccacacccgctc
tacaacatgagcctcctgaagaatcgatacctcgggccaggtgatgactccagccacgac
ctcatgctgctccgcctgtcagagcctgccgagatcacagatgctgtgcaggtcctggac
ctgcccacctgggagccagagctggggaccacgtgctacgcctcaggctggggcagcatc
gaaccggaggaacacttgactccaaagaaacttcagtgtgtggacctccatattatttcc
aatgatgtgtgtgcgcaagttcactctcagaaggtgaccaagttcatgctgtgtgctgga
agctggatgggcggcaaaagcacctgctcgggtgattctgggggcccactggtctgtgac
ggtgtgcttcaaggtatcacgtcatggggcagtcaaccatgtgccctaccccgaaggcct
tccctgtacaccaaggtggtgcgttaccggaagtggatccaggacaccatcatggcaaac
ccctga

DBGET integrated database retrieval system