KEGG   Macaca mulatta (rhesus monkey): 719479
Entry
719479            CDS       T01028                                 

Gene name
CSNK1D
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04340  Hedgehog signaling pathway
mcc04390  Hippo signaling pathway
mcc04540  Gap junction
mcc04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    719479 (CSNK1D)
   04390 Hippo signaling pathway
    719479 (CSNK1D)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    719479 (CSNK1D)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    719479 (CSNK1D)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     719479 (CSNK1D)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   719479 (CSNK1D)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    719479 (CSNK1D)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 719479
NCBI-ProteinID: XP_014976130
Ensembl: ENSMMUG00000018329
UniProt: A0A5F8A113
LinkDB
Position
16
AA seq 427 aa
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMSTSQRSRDMASLRLHAARQGTRCRP
QRPRRTY
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggagctgagagtcgggaacaggtaccggctgggccggaagatcggcagcggctccttc
ggagacatctatctcggtacggacattgctgcaggagaagaagttgccatcaagcttgaa
tgtgtcaaaaccaaacaccctcagctccacattgagagcaaaatctacaagatgatgcag
ggaggagtgggcatccccaccatcagatggtgcggggccgagggggactacaacgtcatg
gtgatggagctgctggggccgagcctggaggacctcttcaacttctgctccaggaaattc
agcctcaaaaccgtcctgctgcttgccgaccaaatgatcagtcgcatcgaatacattcat
tcaaagaacttcatccaccgggatgtgaagccagacaacttccttatgggcctggggaag
aagggcaacttggtgtacatcatcgacttcgggctggccaagaagtaccgggacgcacgc
acccaccagcacatcccctatcgcgagaacaagaacctcacagggacggcgcggtacgcc
tccatcaacacgcaccttggaattgagcaatcccgaagagatgacttggagtctctgggc
tacgtgctaatgtacttcaacctgggctctctcccctggcaggggctgaaggccgccacc
aagagacagaaatatgaaaggattagcgagaagaaaatgtccacccccattgaagtgttg
tgtaaaggctacccttccgagtttgccacatacctgaatttctgccgttccttgcgtttt
gacgacaagcctgactactcgtacctgaggcagcttttccggaatctgttccatcgccag
ggcttctcctacgactacgtgttcgactggaacatgctgaaatttggtgccagccgggcc
gccgacgacgccgagcgggagcgcagggaccgagaggagcggctgagacactcacggaac
ccggctacccgcggcctcccttccacagcctccggccgcctgcgggggacgcaggaagtg
gctccccccacacccctcacccctacctcacacacggctaacacctccccccggcccgtc
tccggcatggagagagagcggaaagtgagtatgcggttgcaccgcggggcccccgtcaac
atctcctcgtccgacctcacgggccgacaagatacctctcgcatgtccacctcacagagg
agcagggacatggcatctctccggctgcacgcagcccgccagggcacccgctgccgtccc
cagcgcccacgacgcacctactga

DBGET integrated database retrieval system