KEGG   Macaca mulatta (rhesus monkey): 720079
Entry
720079            CDS       T01028                                 

Gene name
SLC9A1
Definition
(RefSeq) sodium/hydrogen exchanger 1 isoform X3
  KO
K05742  solute carrier family 9 (sodium/hydrogen exchanger), member 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04024  cAMP signaling pathway
mcc04260  Cardiac muscle contraction
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04371  Apelin signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc04919  Thyroid hormone signaling pathway
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc04976  Bile secretion
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    720079 (SLC9A1)
   04024 cAMP signaling pathway
    720079 (SLC9A1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    720079 (SLC9A1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    720079 (SLC9A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    720079 (SLC9A1)
   04261 Adrenergic signaling in cardiomyocytes
    720079 (SLC9A1)
  09154 Digestive system
   04970 Salivary secretion
    720079 (SLC9A1)
   04971 Gastric acid secretion
    720079 (SLC9A1)
   04972 Pancreatic secretion
    720079 (SLC9A1)
   04976 Bile secretion
    720079 (SLC9A1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    720079 (SLC9A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    720079 (SLC9A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcc02000]
    720079 (SLC9A1)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     720079 (SLC9A1)
Transporters [BR:mcc02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   720079 (SLC9A1)
SSDB
Motif
Pfam: Na_H_Exchanger NEXCaM_BD OprF
Other DBs
NCBI-GeneID: 720079
NCBI-ProteinID: XP_014987781
UniProt: H9FYP5
LinkDB
Position
1
AA seq 608 aa
MYAVCLVGGEQINNIGLLDNLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLND
AVTVVLYHLFEEFANYEHVGIVDIFLGFLSFFVVALGGVFVGVVYGVIAAFTSRFTSHIR
VIEPLFVFLYSYMAYLSAELFHLSGIMALIASGVVMRPYVEANISHKSHTTIKYFLKMWS
SVSETLIFIFLGVSTVAGSHHWNWTFVISTLLFCLIARVLGVLGLTWFINKFRIVKLTPK
DQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLFLTAIITVIFFTVFVQGMTIRPLVDLLA
VKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYGHHHWKDKLNRFNKKYVKKCLIAGER
SKEPQLIAFYHKMEMKQAIELVESGGMGKIPSAVSTVSMQNIHPKSLPSERILPALSKDK
EEEIRKILRNNLQKTRQRLRSYNRHTLVADPYEEAWNQMLLRRQKARQLEQKINNYLTVP
AHKLDSPTMSRARIGSDPLAYEPKEDLPVITIDPASPQSPESVDLVNEELKGKVLGLSRD
PAKVVEEDEEDDGGIMMRSKEPSTPGTDDVFTPAPSDSPSSQRIQRCLSDPGPHPEPGEG
EPFIPKGQ
NT seq 1827 nt   +upstreamnt  +downstreamnt
atgtacgccgtgtgcctggtgggcggtgagcagatcaacaacatcggcctcctggacaac
ctgctcttcggcagcatcatctcggccgtggaccccgtggcggttctggctgtctttgag
gaaattcacatcaatgagctgctgcacatccttgtctttggggagtccttgctcaatgac
gccgtcactgtggtcctgtatcacctctttgaggagtttgccaactatgagcacgtgggc
atcgtggacatcttcctcggcttcctgagcttcttcgtggtggccctgggcggggtgttt
gtaggcgtggtctacggggtcatcgcagccttcacctcccgatttacctcgcacatccgg
gtcatcgagccgctcttcgtcttcctctacagctacatggcctacttgtcggccgagctc
ttccacctgtcaggcatcatggcgcttatagcctcgggagtggtgatgcgcccctatgtg
gaggccaacatctcccacaagtcccacaccaccatcaaatacttcctgaagatgtggagc
agcgtcagcgagaccctcatcttcatcttccttggcgtctccacggtggctggctcccac
cactggaactggaccttcgtcatcagcaccctgctcttctgcctcatcgctcgcgtgctg
ggcgtgctgggcttgacctggttcatcaacaagttccgcatcgtgaagctgacccccaag
gaccaattcatcatcgcctatgggggcctgcgaggggccatcgccttctctctgggctac
ctcctggacaagaagcacttccctatgtgtgacctattcctcactgccatcatcactgtc
atcttcttcaccgtctttgtgcagggcatgaccattcggcccctggtagacctgttggct
gtgaagaaaaagcaagagacgaagcgctccatcaacgaggagatccacacgcagttcctg
gaccaccttctgacaggcatcgaggacatctgtggccactacggtcaccaccactggaag
gacaagctcaaccggtttaataagaaatacgtgaagaagtgtctgatagccggcgagcgc
tccaaggagccccaactcatcgccttctaccacaagatggagatgaagcaggccatcgag
ctggtggagagcggaggcatgggcaagatcccctctgccgtctccaccgtctccatgcag
aacatccaccccaagtccctgccttctgagcgcatcctgccagcactgtccaaggacaaa
gaggaggagattcgcaaaatcctgaggaacaacttgcagaagaccaggcagcggctgcgg
tcctacaacagacacacgctggtggcggacccctacgaggaagcctggaaccagatgctg
ctccggaggcagaaggcccggcagctggagcagaagatcaacaactacctgacagtgcca
gcccacaagctggactcgcccaccatgtctcgggcccgcatcggctcagacccgctggcg
tatgagccgaaggaggacctgcctgtcatcaccatcgacccggcctccccgcagtcaccc
gagtctgtggacctggtgaacgaggagctgaagggcaaggtcttggggttgagccgggat
cctgcgaaggtggtggaggaggacgaggaggacgatgggggtatcatgatgcggagcaag
gagccttcgaccccaggaaccgacgatgtcttcacccccgcacccagtgacagccccagc
tcccagaggatacagcgctgcctcagtgacccaggcccgcaccctgagcctggggaggga
gagccgttcatccctaaggggcagtag

DBGET integrated database retrieval system