KEGG   Macaca mulatta (rhesus monkey): 720550
Entry
720550            CDS       T01028                                 

Gene name
TJP1
Definition
(RefSeq) tight junction protein ZO-1 isoform X6
  KO
K05701  tight junction protein 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04520  Adherens junction
mcc04530  Tight junction
mcc04540  Gap junction
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    720550 (TJP1)
   04530 Tight junction
    720550 (TJP1)
   04540 Gap junction
    720550 (TJP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    720550 (TJP1)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     720550 (TJP1)
SSDB
Motif
Pfam: PDZ ZU5 PDZ_6 PDZ_2 Guanylate_kin SH3_2 SH3_1 RPOL_N
Other DBs
NCBI-GeneID: 720550
NCBI-ProteinID: XP_014997230
Ensembl: ENSMMUG00000017878
LinkDB
Position
7
AA seq 1877 aa
MRRLEGLCLRRRRRRRGPARERSGDKMKYQKYLTVLQMAIGVTPSNRGSLLPLKRKLWVT
PSSENPNGATSSVSQGKPSLRRIKGRLHRSKSLDSIDFCELTSTAMEETAIWEQHTVTLH
RAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGQLQENDRVAMVNGVSMDNVE
HAFAVQQLRKSGKNAKITIRRKKKVQIPVSRPDPEPVSDNEEDSYDEEIHDPRSGRSGVV
NRRSEKIWPRDRSASRERSLSPRSDRRSVASSQPAKPTKVTLVKSRKNEEYGLRLASHIF
VKEISQDSLAARDGNIQEGDVVLKINGTVTENMSLTDAKTLIERSKGKLKMVVQRDERAT
LLNVPDLSDSIHSANASERDDISEIQSLASDHSGRSHDRPPRRSRSRSPDQRSEPSDHSR
HSPQQPSNGSLRSRDEERISKPGAVSTPVKHADDHTPKTVEEVTVERNEKQTPSLPEPKP
VYAQVGQPDVDLPVSPSDGVLPNSTHEDGILRPSMKLVKFRKGDSVGLRLAGGNDVGIFV
AGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIREEAVLFLLDLPKGEEVTILAQKKKDVY
RRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNGKLGSWLAIRIGKNHK
EVERGIIPNKNRAEQLASVQYTLPKTAGGDRADFWRFRGLRSSKRNLRKSREDLSAQPVQ
TKFPAYERVVLREAGFLRPVTIFGPIADVAREKLAREEPDIYQIAKSEPRDAGTDQRSSG
IIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQWYPIVVFLNPDSKQGVKTMRMRLCPES
RKSARKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADG
ATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVG
TPPESAITRSSEPVREDSSGMHHENQTYPPYSPQAQPQPIHRIDSPGFKPASQQKAEASS
PVPYLSPETNPASSTSAVNHNVNLTNVRLEEPTPAPSTTYSPQADSLRTPSTEAAHIMLR
DQEPSLSSHVDPTKVYRKDPYPEEMMRQNHVLKQPAVGHPGHRPDKEPNLTYEPQLPYVE
KQASRDLEQPTYRYESSSYTDQFSRNYEHRLRYEDRVPMYEEQWSYYDDKQPYPSRPPFD
NQHSRDLDSRQHPEESSERGYFPRFEEPAPLSYDSRPRYEQAPRASALRHEEQPAPGYDT
HGRHRPETQPYPSAGPKPAEPKQYFEQYSRSYEQVPPQGFTSRAGHFEPLHGAAAVPPLI
PSSQHKPEALPSNTKPLPPPPTQTEEEEDPAMKPQSVLTRVKMFENKRSASLETKKDVND
TATFKPPEVASKPSGAPIIGPKPTSQNQFSEHDKTLYRIPEPQKPQLKPPEDIVRSNHYD
PEEDEEYYRKQLSYFDRRSFENKPPAHIAASHLSEPAKPAHSQNQSNFSSYSSKFLGSYT
SYDYLKRNVKWGKPPEADGVDRSFGEKRYEPLQVTPPPPPLPSQYAQPSQPVTSASLHIH
SKGAHGEGNSVSLDFQNSLVSKPDPPPSQNKPATFRPPNREDAAQPAFYPQKSFPDKAPV
NGTEQTQKTVTPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETAHKPDLSKTPTSP
KTLVKSHSLAQPSEFDSGVETFSIHAEKPKYQINNISTVPKAIPVSPSAVEEDEDEDGHT
VVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGE
TLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGDPKTWQNKCLPGD
PNYLVGANCVSVLIDHF
NT seq 5634 nt   +upstreamnt  +downstreamnt
atgcggcgcctggaggggctgtgtctgcggcggcggcggcggcggcggggccctgcccgc
gagcggagcggggacaagatgaagtaccagaaatacctgacggtgctgcagatggccatc
ggcgtcactccctccaaccgcggcagcctcctgccgctcaagaggaagctgtgggtaacc
ccatcctctgaaaatcctaatggtgctacttctagtgtcagccaaggaaaaccctcttta
agacgaattaaagggagattacacagaagcaaaagccttgatagcatcgatttctgcgag
ctcactagcacagcaatggaggaaacagctatatgggaacaacatacagtgacgcttcac
agggctcctggatttggatttggcattgcaatatctggtggacgagataatcctcatttt
cagagtggggaaacgtcaatcgtgatttcagatgtgctgaaaggaggaccagctgaagga
cagctacaggaaaatgaccgagtggcaatggttaacggagtttcaatggataatgttgaa
catgcttttgctgttcagcaactaaggaaaagtgggaaaaatgcaaaaattacaattaga
aggaagaagaaagttcaaataccagtaagtcgtcctgatcctgaaccagtatctgataat
gaagaagatagttacgatgaggaaatacatgatccaagaagtggccggagtggtgtggtt
aacagaaggagtgagaagatttggccgagggatagaagtgcaagtagagagaggagcttg
tctccgcggtcagacaggcggtcagtggcttccagccagcccgctaaacccaccaaagtc
acactggtgaaatcccggaagaatgaagaatatggtcttcgattggcaagccatatattt
gttaaggaaatttcacaagatagtttggcagcaagagatggcaatattcaagaaggtgat
gttgtattgaagataaatggtactgtgacagaaaatatgtcattgacagatgcaaagaca
ttgatagaaaggtctaaaggcaaattaaaaatggtagttcaaagagatgaacgggctacg
ctgttgaacgtccctgatctgtctgacagcatccactctgctaatgcctctgagagagac
gacatttcagaaattcagtcactggcctcagatcattctggtcgatcacacgataggcct
ccccgccgcagccggtcacgatctcctgaccagcggtcagagccttctgatcattccaga
cactctccacagcagccaagcaatggcagtctccggagtagagatgaagagagaatttct
aagcctggggctgtctcaactcctgtaaagcatgctgatgatcacacacctaaaacagtg
gaagaagttacagttgaaagaaacgagaaacaaacaccttctcttccagaaccaaagcct
gtgtatgcccaggttgggcagccagatgtggatttacctgtcagtccatcagatggtgtc
ctacctaattcaactcatgaagatgggattcttcgacccagcatgaaattggtaaaattc
agaaaaggagatagtgtgggattgcgactggctggtggaaatgatgttggaatatttgta
gctggcgttctagaagatagccctgcagccaaggaaggcttagaggaaggtgatcaaatt
ctcagggtaaacaacgtagattttacaaatatcataagagaagaagccgtccttttcctg
cttgacctccctaaaggagaagaagtgaccatattggctcagaagaagaaggatgtttat
cgtcgcattgtagaatcagatgtaggagattctttctatattagaacccattttgaatat
gaaaaggaatctccctatggacttagttttaacaaaggagaggtgttccgtgttgtggat
accttgtacaatggaaaactgggctcttggcttgctattcgaattggcaaaaatcataag
gaggtagaacgaggcatcatccctaataagaacagagctgagcagctggccagtgtacag
tatacacttccaaaaacagcagggggagaccgggctgacttctggagattccgaggtctt
cgcagctccaagagaaatcttcgaaaaagcagagaggatttgtctgctcagcctgttcaa
acaaagtttccagcttatgaaagagtggttcttcgagaagctggatttctgaggcctgta
accatttttggaccaatagctgatgttgccagagaaaagctggctagagaagaaccagat
atttatcaaattgcaaagagtgaaccacgagacgctggaactgaccaacgtagctctggc
attattcgcctgcatacaataaagcaaatcatagatcaagacaaacatgctttattagat
gtaacaccaaatgcagttgatcgtcttaactatgcccagtggtatccaattgttgtattt
cttaatcctgattctaagcaaggagtaaaaacaatgagaatgaggttatgtccagaatct
cggaaaagtgccaggaagttatatgagcgatctcataaacttcgtaaaaataatcaccat
ctttttacaactacaattaacttaaattcaatgaatgatggttggtatggtgcactgaaa
gaagcaattcaacagcagcaaaaccagctggtgtgggtttctgagggaaaggcggatggt
gctacaagtgatgaccttgatttgcatgatgatcgtctgtcctacctgtcagctccaggt
agtgaatactcaatgtatagcacggacagtagacacacttctgactatgaagacacagac
acagaaggcggggcctacactgatcaagaactagatgaaactcttaatgatgaggttggg
actccaccggagtctgccattacacggtcctctgagcctgtaagagaggactcctctgga
atgcatcatgaaaaccaaacatatcctccttactcaccacaagcgcagccacaaccaatt
catagaatagactcccctggatttaagccagcctctcaacagaaagcagaagcttcatct
ccagtcccttacctttcgcctgaaacaaacccagcatcatcaacctctgctgttaatcat
aatgtaaatttaactaatgtcagactggaggagcccaccccagctccttccaccacttac
tcaccacaagctgattctttaagaacaccaagtactgaggcagctcacataatgctaaga
gatcaagaaccatcattgtcgtcgcatgtagatccaacaaaggtgtacagaaaggatcca
tatcccgaggaaatgatgagacaaaaccatgttttgaaacagccagccgttggtcaccca
gggcacaggccagacaaagagcctaatctgacctatgaaccccaactcccatacgtagag
aaacaagccagcagagaccttgagcagcccacgtacagatacgagtcctcaagctatacg
gaccagttttctcgaaactatgaacatcgtctgcgatacgaagatcgcgtccccatgtat
gaagaacagtggtcatattatgatgacaaacagccctacccatctcggccaccttttgat
aatcagcactctcgagaccttgactccagacagcatcccgaagagtcttcagaacgcggg
tactttccacgttttgaagagccagcccctctgtcctatgacagcagaccacgttacgaa
caggcacctagagcgtctgccctgcggcacgaagagcagccagctcctgggtatgacacg
catggtagacacaggccggaaacccagccctacccttcagcagggcccaagcccgcagag
cccaagcagtattttgagcaatattcacgcagttacgagcaagtcccaccccaaggattt
acctctagagcaggtcattttgagcctctccatggtgctgcagctgtccctccgctgata
ccttcatctcagcataagccagaagctctgccttcaaataccaaaccgctgcctccaccc
ccaactcaaaccgaagaagaggaagatccagcaatgaagccacagtctgtactcaccaga
gttaagatgtttgaaaacaaaagatctgcatccttagagaccaagaaggatgtaaatgac
actgccacttttaagcctccagaagtagcatctaaaccttcaggtgctcccatcattggt
cccaaacccacttctcagaatcaattcagtgaacatgacaaaactctatacaggatccca
gaacctcaaaagcctcaactgaagccacctgaagatatcgttcggtcaaatcattatgac
cctgaagaagatgaagaatattatcgaaaacagctctcatactttgaccgaagaagtttt
gagaataagcctcctgcacacattgctgccagccatctctccgagcctgcaaagccagct
cattctcagaatcaatcaaatttttctagttattcttcaaaatttcttggctcttacact
agctatgactacttgaaaaggaacgtcaagtggggaaagcctcctgaagctgatggtgta
gatagatcatttggtgagaaacgctatgaacccctccaggtcactccccctcctcctcca
ttgccctcgcagtacgcccagccatctcaacctgtcaccagcgcatctctccacatacat
tctaagggagcacatggtgaaggtaattcagtgtcattggattttcagaattccttagtg
tccaaaccagacccacctccgtctcagaataagccagcaactttcagaccaccaaaccga
gaagatgctgctcagccagctttctatccccagaaaagttttccagataaagccccagtt
aatggaactgaacagactcagaaaacggtcactccagcatacaatcgattcacaccaaaa
ccatatacaagttctgcccgaccgtttgaacgcaagtttgaaagtcctaaattcaatcac
aatcttctgccaagtgaaactgcacataaacctgacttgtcaaaaactcccacttctcca
aaaactcttgtgaaatcgcacagtttggcacagccttctgagtttgacagtggagttgaa
actttctctatccatgcagagaagcctaaatatcaaataaataatatcagcacagtgcct
aaagctattcctgtgagtccttcagctgtggaagaggatgaagatgaagatggtcatact
gtggtggccacagcgcgaggcatatttaacagcaatggtggcgtgctgagttccatagaa
actggagtcagtataattatccctcaaggagccattcccgaaggagttgagcaggaaatc
tatttcaaggtctgccgagacaacagcatcctcccacctttagataaagagaaaggtgaa
acactgctgagtcccttggtgatgtgtggtccccatggcctcaagttcctgaagcctgtg
gagctgcgcttaccacactgtgcgtccatgactcctgacggttggtcttttgctctaaaa
tcatccgactcctcgtcgggtgatcctaaaacctggcaaaacaagtgtcttcctggagat
ccaaattatctcgttggagcaaactgtgtttctgtccttattgaccacttttaa

DBGET integrated database retrieval system