KEGG   Macaca mulatta (rhesus monkey): 721052Help
Entry
721052            CDS       T01028                                 

Gene name
ALPI
Definition
(RefSeq) alkaline phosphatase, intestinal
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00730  Thiamine metabolism
mcc00790  Folate biosynthesis
mcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    721052 (ALPI)
   00790 Folate biosynthesis
    721052 (ALPI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    721052 (ALPI)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
    721052 (ALPI)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     721052 (ALPI)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   721052 (ALPI)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
 Enzymes
  721052 (ALPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase
Motif
Other DBs
NCBI-GeneID: 721052
NCBI-ProteinID: XP_014966837
Ensembl: ENSMMUG00000016871
UniProt: F6T9X2
LinkDB All DBs
Position
12
AA seq 550 aa AA seqDB search
MQGPWVLLLLGLRLQLSLGIIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLG
DGMGVPTVTAARILKGQKNGKLGPETPLAMDGFPYVALSKTYNVDRQVPDSAGTATAYLC
GVKANYQTIGLSAAARYNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYA
HTVNRNWYSDADMPASARQDGCQDIATQLISNVDIDVILGGGRKYMFPRGTPDPEYPSDA
SQNGIRLDGKYLVQEWLTKHQGARYVWNRTELMQASLDQSVTHLMGLFEPGDMKYEINRD
PTLDPSLLEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGLAYHALTEAVMFDDAIERA
GQLTSEEDTLTLITADHSHVFSFGGYTFRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVL
NSGVRPDVNESESGSPDYRQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHV
MAFAACLEPYTACDLAPPAGTTDTAPPAPAGTTDTAPPAPAGTTDAAHPVPASLPLLAGT
LLLLGAAAAP
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggccctgggtgctgctgctgctgggcctgaggctacagctctccctgggcatc
atcccagctgaggaggagaacccagccttctggaaccgccaggcagctgaggccctggat
gccgccaagaagctgcagcccatccagaaggtcgccaagaacctcatcctcttcctgggt
gatgggatgggggtgcccacggtgacagccgctaggatcctaaaggggcagaagaatggc
aaactggggcctgagacgcccctggccatggacggcttcccatacgtggcgctatccaag
acgtacaatgtggacagacaggtgccagacagcgcaggcacagccacagcctacctgtgc
ggggtcaaggccaactaccagaccatcggcttgagtgcagccgcccgctataaccagtgc
aacacgacacgcggcaatgaggtcatctctgtgatgaaccgggccaagaaagcaggaaag
tcagtgggagtggtgaccaccacacgggtgcagcatgcctcgccagccggcacctacgca
cacacggtgaaccgcaactggtactcagatgctgacatgcctgcctcggcccgccaggat
ggctgccaggacattgccacacagctcatctccaacgtggacattgacgtgatcctgggt
ggaggccgcaagtacatgtttcccagggggaccccagaccctgagtacccaagtgatgcc
agccagaatggaatcagactggacgggaagtacctggtgcaggaatggctgacaaagcac
cagggtgcccggtacgtgtggaaccgcactgagctcatgcaggcttccctggaccagtct
gtgacccatctcatgggcctctttgaacccggagacatgaaatatgagatcaaccgagac
cccacactggacccctccctgctggagatgacagaggctgccctgcgcctgctgagcagg
aacccccgcggcttctacctcttcgtggaaggtggtcgcatcgaccatggtcatcatgag
ggcttggcttaccatgcgctcaccgaggcggtcatgtttgatgatgccatcgagagggca
ggccagctcaccagcgaggaggacacgctgaccctcatcactgctgaccactcccacgta
ttctcctttggtggctacacctttcgagggagctccatcttcgggttggcccccagcaag
gctcaggacagcaaagcctacacgtccatcctgtacggcaatggcccgggctacgtgctc
aactcaggcgtgcgaccagacgtgaatgagagtgagagcgggagccccgattaccggcag
caggcggcggtgcccctgtcgtccgagacccacggaggcgaagacgtggcggtgttcgcg
cgcggtcctcaggcgcacctggtgcacggtgtgcaggagcagagcttcgtagcgcacgtc
atggcctttgccgcctgcctggagccctacacggcctgcgacctggcaccccccgccggc
accaccgacaccgcgcctcccgctcccgccggcaccaccgacaccgcgcctcccgctccc
gccggcaccaccgacgctgcgcacccggttcccgcgtcgctgcctctgctggccgggacc
ctgctgctgctgggggcggccgctgctccctga

DBGET integrated database retrieval system