KEGG   Macaca mulatta (rhesus monkey): 721489Help
Entry
721489            CDS       T01028                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mcc01002]
    721489 (TMPRSS9)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     721489 (TMPRSS9)
Peptidases [BR:mcc01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   721489 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 Ldl_recept_a SEA
Motif
Other DBs
NCBI-GeneID: 721489
NCBI-ProteinID: XP_014977911
Ensembl: ENSMMUG00000001190
LinkDB All DBs
Position
19
AA seq 1081 aa AA seqDB search
MESTVADVHLVPRTTKEIPTPDAACCRVTTIGVVATSLVILTLGVLLAFLSTQGVHVDHT
AELRGIRWASSLRQEASDYHRTLTPTLEALFVSSFQKTELEASCVGCTVLNYRDGNSSVL
VHFRLRFLLRPLQTLSLGLEEELLQRGIQARLRERGISLAAYGTIVSAELTGHCPGNSFS
CQNSQCVTKVNPECDDQEDCSDGSDEVHCECGLQPAWRMAGRIVGGVEASPGEFPWQASL
RENKEHFCGATIISARWLVSAAHCFNEFQDPTEWVAYVGTTYLSGSEASTVRARVAQIIK
HPLYNADTADFDVAVLELTSPLPFGRHIQPVCLPAATHIFPPSKKCLISGWGYLKEDFLV
KPEVLQKATVELLDQALCASLYGHSLTDRMLCAGYLDGKVDSCQGDSGGPLVCEEPPGRF
FLAGIVSWGIGCAEARRPGVYARVTKLRDWILEATTRASVPPAPTVAPAPAALSTAWPTG
PESPVVNTPTKSTQAPSTVPLDWVTVPKLQECGARPAMEKPTRVVGGFGAASGEVPWQVS
LKEGSRHFCGATVVGDRWLLSAAHCFNHTKVEQVWAHLGTASLLGLGGSPVKIGLRRVVL
HPLYNPGILDFDLAVLELASPLAFNKYIQPVCLPLAIQKFPVGRKCMISGWGNMQEGNAT
KPELLQKASVGIIDQKTCSVLYNFSLTDRMICAGFLEGKVDSCQGDSGGPLACEEAPGVF
YLAGIVSWGIGCAQVKKPGVYTRITRLKGWILEIMSSQPLPVSPPSTTRTLATTSHPPRT
TAGLTVPGATPSRPTPGAASRVTGQPANSALSAMSTTARGQMPFPHALEATTHSQLPDCG
LAPAALSRIVGGSAAGRGEWPWQVSLWLRRREHRCGAVLVAERWLLSAAHCFDLYGDPKQ
WAAFLGTPFLSGAEGQLERVARIYKHPFYNLYTLDYDVALLELAGPVRRSRLVRPICLPE
PVPRPPDGARCVITGWGSVREGGSMARQLQKAAVRLLSEQTCRRFYPVQISSRMLCAGFP
QGGVDSCSGDAGGPLACREPSGRWVLTGVTSWGYGCGRPHFPGVYTRVAAVRGWIGQHIQ
E
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atggagtctactgtggctgacgtacacctcgtgcccaggacaaccaaggaaatccccact
ccggacgctgcatgttgtcgagtgaccaccattggtgtggtggccaccagccttgtcatc
ctcaccctgggagtccttttggccttcctctctacacagggcgtccacgtggaccacacg
gccgagctgcggggaatccgatgggccagcagtttgcggcaggaggcctcggactatcac
cgcacactgacgcccaccctggaggcactgtttgtaagtagttttcagaagacagagtta
gaggcaagctgcgtgggttgcacggtgctgaattacagggatgggaactccagtgtcctc
gtacatttccggttgcgctttctgctgcgacccctccagacgctgagcctgggcctggag
gaggagctattgcagagagggatccaggcaaggctgcgagagcgtggtatctccctggct
gcctatggcacaatcgtgtcggccgagctcacaggccactgtccagggaactccttttcc
tgccagaacagccagtgtgtgaccaaggtgaacccggagtgtgacgaccaggaggactgc
tccgatgggtccgatgaggtgcactgtgagtgtggcttgcagcctgcctggaggatggcc
ggcaggatcgtgggcggtgtggaagcatccccgggggagtttccatggcaagccagcctt
cgagagaacaaggagcacttctgtggggccaccatcatcagtgccaggtggctggtatct
gccgctcactgcttcaatgaattccaagacccgacggagtgggtggcctacgtgggtacg
acctacctcagtggctcggaggccagcaccgtgcgggcccgggtggcccagatcatcaag
caccccctgtacaacgcagacacggccgacttcgacgtggcagtgctggagctgaccagc
cctctgcctttcggccggcacatccagcccgtgtgcctcccggctgccacacacatcttc
ccacccagcaagaagtgcctgatctcaggctggggctacctcaaggaggatttcctggtc
aagccagaggtgctgcagaaagccactgtggaactgctggaccaggcactgtgtgccagc
ctgtacggccactcactcactgacaggatgttgtgtgctggctacctggacgggaaggtg
gactcctgccagggcgactcaggaggacccctggtctgcgaggagccccctggccggttc
tttctggccggcatcgtgagctggggaattggctgtgcagaagcccggcgtccgggggtc
tatgcccgagtcaccaagctacgtgactggatcctggaggccaccaccagagccagcgtg
cctccggcccccacggtggctcctgcccccgccgccctcagcacggcctggcccaccggt
cctgagagccctgtggtcaacacccccaccaaatccacacaggcccccagcactgtgcct
cttgactgggtcaccgttcctaagctacaagaatgtggggccaggcctgcaatggagaag
cccacccgggtcgtgggcgggttcggagctgcctccggggaggtgccctggcaggtcagc
ctgaaggaagggtcccggcacttctgtggagcgactgtggtgggggaccgctggctgctg
tctgccgcccactgcttcaaccacacaaaggtggagcaggtttgggcccacctgggcact
gcgtccctcctgggcctgggcgggagcccggtgaagatcgggctgcggcgggtggtgcta
caccccctctacaaccctggcatcctggacttcgacctggctgtcctggagctggccagc
cccctggccttcaacaaatacatccagcctgtctgcctgcccctggccatccagaagttc
cctgtgggccggaagtgcatgatctccggatggggaaatatgcaggaaggaaatgccacc
aagcccgagctcctgcagaaggcgtccgtgggcatcatagaccagaagacctgtagcgtg
ctctacaacttctccctcacagaccgcatgatctgcgctggcttcctggaaggcaaagtt
gactcctgccagggtgactctgggggccccctggcctgcgaggaggcccccggcgtgttt
tatctggcagggattgtgagctggggtattggctgcgctcaggttaagaagccgggcgtc
tacacgcgcatcaccaggctaaagggctggatcctggagatcatgtcttcccagcccctt
cccgtgtctcccccctcgaccacaaggacactggccaccaccagccatccccccaggacg
acagctggcctcacagtcccgggggccacacccagcagacccacccctggggccgccagc
agggtgacgggccaacctgccaactcagccttatctgccatgagcaccactgctagggga
cagatgccatttccacatgccctggaggccaccacgcactcccagctaccagactgcggc
ctggcgccggcggcgctcagcaggattgtgggcggcagcgcagcgggccgcggggagtgg
ccgtggcaggtgagcctgtggctgcggcgccgggaacaccgctgtggggccgtgctggtg
gcagagaggtggctgctgtcggcggcgcactgcttcgacctctacggggaccccaagcag
tgggcagccttcctaggcacgccgttcctgagcggcgcggaggggcagctggagcgcgtg
gcgcgcatctacaagcacccgttctacaatctctacacgctcgactacgacgtggcgctg
ctggagctggcggggccggtgcgccgcagccgcctggtgcgtcccatctgcctgcccgag
cccgtgccgcgacccccagacggtgcgcgctgcgtcatcaccggctggggctcggtgcgc
gaaggaggctccatggcgcggcagctgcagaaggcggccgtgcgcctcctcagcgagcag
acctgccgccgcttctacccggtgcagatcagcagccgcatgctgtgtgccggcttcccg
cagggcggcgtggacagctgctcgggtgacgctgggggacccctggcctgcagggagccg
tctggacgatgggtgctaactggggtcaccagctggggctatggctgcggccggccccac
ttcccaggtgtctatacccgggtggcagctgtgagaggctggataggacagcacatccag
gagtga

DBGET integrated database retrieval system