KEGG   Macaca mulatta (rhesus monkey): 721704
Entry
721704            CDS       T01028                                 

Gene name
GSTP1
Definition
(RefSeq) glutathione S-transferase P
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00480  Glutathione metabolism
mcc00980  Metabolism of xenobiotics by cytochrome P450
mcc00982  Drug metabolism - cytochrome P450
mcc00983  Drug metabolism - other enzymes
mcc01100  Metabolic pathways
mcc01524  Platinum drug resistance
mcc05200  Pathways in cancer
mcc05204  Chemical carcinogenesis
mcc05215  Prostate cancer
mcc05225  Hepatocellular carcinoma
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    721704 (GSTP1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    721704 (GSTP1)
   00982 Drug metabolism - cytochrome P450
    721704 (GSTP1)
   00983 Drug metabolism - other enzymes
    721704 (GSTP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    721704 (GSTP1)
   05204 Chemical carcinogenesis
    721704 (GSTP1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    721704 (GSTP1)
   05215 Prostate cancer
    721704 (GSTP1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    721704 (GSTP1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    721704 (GSTP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcc02000]
    721704 (GSTP1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     721704 (GSTP1)
Transporters [BR:mcc02000]
 Other transporters
  Pores ion channels [TC:1]
   721704 (GSTP1)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Other DBs
NCBI-GeneID: 721704
NCBI-ProteinID: NP_001036141
Ensembl: ENSMMUG00000018524
UniProt: Q28514 H9Z845
LinkDB
Position
14
AA seq 210 aa
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTMETWQEGSLKASCLYGQLPKFQDGD
LTLYQSNTFLRHLGRTLGLYGKDQREAALVDMVNDGVEDLRCKYLSLIYTNYEAGKDDYV
KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
VARLSARPKLKAFLASPEHVNLPINGNGKQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atgccgccctacaccgtggtctacttcccagttcgaggccgctgcgcggccctgcgcatg
ctgctggcagaccagggccagagctggaaggaggaggtggtgacaatggagacctggcaa
gagggttctctcaaagcctcctgcctgtatgggcagctccccaagttccaggacggagac
ctcaccctgtaccagtccaataccttcctgcgtcacctgggccgcactcttgggctctat
gggaaggaccagcgggaggcagccctggtggacatggtgaatgacggcgtggaggacctc
cgctgcaaatacctctccctcatctacaccaactacgaggcaggcaaggatgactatgtg
aaggcactgcccgggcaactgaagccttttgagaccctgctgtcccagaaccagggaggc
aagaccttcattgtgggagaccagatctccttcgctgactacaacctgctggacttgctg
ctgatccatgaggtcctggcgcccggctgcctggatgcgttccccctgctctcggcatat
gtggcgcgcctcagtgcccggcccaagctcaaggctttcctggcctcccctgagcacgtg
aacctccccatcaatggcaacgggaaacagtga

DBGET integrated database retrieval system