KEGG   Macaca mulatta (rhesus monkey): 721721
Entry
721721            CDS       T01028                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X13
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04260  Cardiac muscle contraction
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04713  Circadian entrainment
mcc04720  Long-term potentiation
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04727  GABAergic synapse
mcc04728  Dopaminergic synapse
mcc04742  Taste transduction
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04924  Renin secretion
mcc04925  Aldosterone synthesis and secretion
mcc04927  Cortisol synthesis and secretion
mcc04929  GnRH secretion
mcc04930  Type II diabetes mellitus
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc05010  Alzheimer disease
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05031  Amphetamine addiction
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    721721 (CACNA1C)
   04020 Calcium signaling pathway
    721721 (CACNA1C)
   04024 cAMP signaling pathway
    721721 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    721721 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    721721 (CACNA1C)
   04929 GnRH secretion
    721721 (CACNA1C)
   04912 GnRH signaling pathway
    721721 (CACNA1C)
   04921 Oxytocin signaling pathway
    721721 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    721721 (CACNA1C)
   04924 Renin secretion
    721721 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    721721 (CACNA1C)
   04927 Cortisol synthesis and secretion
    721721 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    721721 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    721721 (CACNA1C)
   04270 Vascular smooth muscle contraction
    721721 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    721721 (CACNA1C)
   04727 GABAergic synapse
    721721 (CACNA1C)
   04725 Cholinergic synapse
    721721 (CACNA1C)
   04728 Dopaminergic synapse
    721721 (CACNA1C)
   04726 Serotonergic synapse
    721721 (CACNA1C)
   04720 Long-term potentiation
    721721 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    721721 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    721721 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    721721 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    721721 (CACNA1C)
   05020 Prion disease
    721721 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    721721 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    721721 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    721721 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    721721 (CACNA1C)
   05414 Dilated cardiomyopathy
    721721 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    721721 (CACNA1C)
   04934 Cushing syndrome
    721721 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcc04040]
    721721 (CACNA1C)
Ion channels [BR:mcc04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   721721 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 721721
NCBI-ProteinID: XP_015006258
Ensembl: ENSMMUG00000012988
LinkDB
Position
11
AA seq 2187 aa
MLRAFVQPGTPAYQPLPSHLSADTEVKFKGTLVHEAQLNYFYISPGGSNYGSPRPAHANM
NANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGT
VCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVI
FGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWN
RFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAE
MLLKMYSLGLQAYFVSLFNRFDCFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKI
TRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFD
NFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLA
IAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEMVEKPAVEESKEEKIELKSIT
ADGESPPTTKINMDDLQPNENEDKSPYPNPETTGEEDEEEPEMPVGPRPRPLSELHLKEK
AVPMPEASAFFVFSSNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRN
HILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSA
INVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQL
FKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFT
VSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQ
EQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLIL
LNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKHYFCDAWNTFDALI
VVGSIVDIAITEVNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLL
WTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLF
RCATGEAWQDIMLACMPGKKCAPESEPGNSTEGETPCGSSFAVFYFISFYMLCAFLIINL
FVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGF
GKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEEGPSPSEAHQGAEDP
FRPAGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKF
KKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAAS
EDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKAGSSQGDTESPSHEKLVDS
TFTPSSYSSTGSNANINNANNTALGRLPRPAGYPSTVSTVEGHGPPLSPAIRVQEVAWKL
SSKRCHSGESQTAMVGPEETSQDETYEVKMNHDAEACSEPSLLSTDMLSYQDDENRQLTL
PEEDKRDMRQSPKRGFLRSASLGRRASFHLECLKRQKDRGGDISQKTVLPLHLVHHQALA
VAGLSPLLQRSHSPASFPRPFATPPATPGSRGWPPQPIPTLRLEGAESSEKLNSSFPSIH
CGSWAETTPGGGDSNTTRRARPVSLMVPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQ
DPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAGQDRAGGE
EDAGCARARGRLSEEELQDSRVYVSSL
NT seq 6564 nt   +upstreamnt  +downstreamnt
atgcttcgagcctttgttcagcctggtacgcctgcataccagccgcttcccagccacctg
tctgccgacacggaggtcaagtttaagggtactttggtgcacgaagctcaactcaactat
ttctacatctctcctggaggttccaactatgggagcccacgccccgcccatgccaacatg
aatgccaatgcggccgcgggactggcccctgagcacatccccaccccgggggccgccctg
tcctggcaggcggccatcgacgcagcccggcaggcgaagctgatgggcagcgctggcaac
gcgaccatctccacagtcagctccacgcagcggaagcggcagcaatatgggaaacccaag
aagcagggcagcaccacggccacacgcccgccccgagccctgctctgcctgaccctgaag
aaccccatccggagggcctgcatcagcattgtcgaatggaaaccatttgaaataattatt
ttactgactatttttgccaattgtgtggccttagcgatctatattccctttccagaagat
gattccaacgccactaattccaacctggaacgagtggaatatctctttctcataattttt
acggtggaagcatttttaaaagtcatcgcctatggactcctctttcaccccaatgcctac
ctccgcaacggctggaatctgctcgattttatcattgtggtcgtggggctttttagcgca
attttagaacaagcaaccaaagcagacggggcgaacgctctcggagggaaaggggccgga
tttgatgtgaaagcgctgagggccttccgcgtgctgcgccccctgcggctggtgtctgga
gtcccaagtctccaggtggtcctgaattccatcatcaaggccatggtccccctgctgcac
atcgccctgctcgtgctgtttgtcatcatcatctatgccatcatcggcctggagctcttc
atggggaagatgcacaagacctgctacaaccaggagggcatagcagatgttccagcagaa
gatgacccttccccttgtgcgctggaaacaggccatgggcggcagtgccagaacggcacg
gtgtgcaagcccggctgggatggtcccaagcacggcatcaccaactttgacaactttgcc
ttcgccatgctcacggtgttccagtgcatcaccatggagggctggacggacgtgctgtac
tggatgcaggacgctatgggctatgagttaccctgggtgtattttgtcagtctggtcatc
tttggatcctttttcgttctaaatctggttctcggtgtgttgagcggagagttttccaaa
gagagggagaaggccaaggcccggggagatttccagaagctgcgggagaagcagcagctg
gaagaggatctcaaaggctacctggactggatcactcaggccgaagacatcgatcccgag
aacgaggacgaaggcatggatgaggagaagccccgaaacatgagcatgcccaccagtgag
actgagtccgtcaacaccgaaaacgtggctggaggtgacatcgagggagaaaactgcggg
gccaggctggcccaccggatctccaagtcaaagttcagccgctactggcgccggtggaat
cggttctgcagaagaaagtgccgtgccgcggtcaagtctaatgtcttctactggctggtg
attttcctggtgttcctcaacacgctcaccattgcctctgagcactacaaccagccccac
tggctcacggaagtccaagacacggcgaacaaggccctgctggcgctgttcacggcagag
atgctgctgaagatgtacagcctgggcctgcaggcctacttcgtgtccctcttcaaccgc
tttgactgcttcgtcgtgtgtggcggcatcctggagaccatcctggtagagaccaagatc
atgtccccactgggcatctccgtgctccgatgcgtccggttgctgaggatattcaagatc
acgaggtactggaactccttgagcaacctggtggcatccttgctgaactctgtgcgctcc
atcgcctccctgctccttctcctattcctcttcatcatcatcttctccctcctggggatg
cagctctttggaggaaagttcaactttgatgagatgcagacccggaggagcacatttgat
aacttcccccagtccctcctcactgtgtttcagatcctgaccggggaggactggaattcg
gtgatgtatgatgggatcatggcttatggcggcccctcttttccagggatgttagtctgt
atttacttcatcatcctcttcatctgtggaaactatatcctactgaatgtgttcttggcc
attgctgtggacaacctggctgacgctgagagcctcacatctgcccaaaaggaggaggaa
gaggagaaggagagaaagaagctggccaggactgccagcccagagaagaaacaagagatg
gtggagaagccggcagtggaggaatccaaggaggagaagattgagctgaaatccatcaca
gctgacggagagtctccacccaccaccaagatcaacatggatgacctccagcccaatgaa
aatgaggataagagcccctaccccaacccagagactacaggagaagaggatgaggaggag
ccagagatgcctgtcggccctcgcccacgcccactctctgagcttcaccttaaggaaaag
gcagtgcccatgccagaagccagtgcgtttttcgtcttcagctctaacaacaggtttcgc
ctgcagtgccaccgcattgtcaacgacacgatcttcaccaacctgatcctcttcttcatt
ctgctcagcagcatttccctggctgctgaggacccggtccagcacacctccttcaggaac
cacatcctaggcaatgcagactatgtcttcactagtatctttacattagaaattatcctt
aagatgactgcttatggggcttttctgcacaagggctccttctgccggaactacttcaac
atcctggacctgctggtggtcagcgtgtccctcatctcctttggcatccagtccagtgca
atcaatgtcgtgaagatcttgcgagtcctgcgagtactcaggcccctgagggctatcaac
agggccaaggggctaaagcatgtggttcagtgtgtgtttgtcgccatccggaccatcggg
aacatcgtgattgtcaccaccctgctgcagttcatgttcgcctgcatcggggtccagctc
ttcaagggaaagctgtacacctgttcagacagttccaagcagacagaggcggaatgcaag
ggcaactacatcacgtacaaagacggggaggttgaccaccccatcatccaaccccgtagc
tgggagaacagcaagtttgactttgacaatgttctggccgccatgatggccctcttcacc
gtctccaccttcgaagggtggccagagctgctgtaccgctccatcgactcccacaccgaa
gacaagggtcccatctacaattaccgcgtggagatctccatcttcttcatcatctacatc
atcatcatcgccttcttcatgatgaacatcttcgtgggcttcgtcatcgtcaccttccag
gagcagggggagcaggagtacaagaactgtgagctggacaagaaccagcgacagtgtgtg
gaatacgccctcaaggcccggcccctgcggaggtatatccccaagaaccagcaccagtac
aaagtgtggtacgtggtcaactccacctacttcgagtacctgatgttcgtcctcatcctg
ctcaacaccatctgcctggccatgcagcactacggccagagctgcctgttcaaaatcgcc
atgaacatcctcaacatgctcttcactggcctcttcaccgtggagatgatcctgaagctc
attgccttcaaacccaagcactatttctgtgatgcatggaatacatttgacgccttgatt
gttgtgggtagcattgttgatatagcaatcaccgaggtaaacccagctgaacatacccaa
tgctctccctctatgaacgcagaggaaaactcgcgcatctccatcaccttcttccgccta
ttccgggtcatgcgcctggtgaagctgctgagccgcggggagggcatccggacgctgctg
tggaccttcatcaagtccttccaggccctgccctatgtggccctcctgatcgtgatgctg
ttcttcatctacgcggtgatcgggatgcaggtgtttgggaaaattgccctgaatgatacc
acagagatcaaccggaacaacaactttcagaccttcccccaggccgtgctgctcctcttc
aggtgtgccaccggggaggcctggcaggacatcatgctggcctgcatgccaggcaagaag
tgtgccccggagtccgagcccggcaacagcacggagggtgagacaccctgtggcagcagc
tttgccgtcttctacttcatcagcttctacatgctctgtgccttcctgatcatcaacctc
tttgtagctgtcatcatggacaactttgactacctgacaagggactggtccatccttggt
ccccaccacctggatgagtttaaaagaatctgggcagagtatgaccctgaagccaagggt
cgtatcaaacacctggatgtggtgaccctcctccggcggattcagcccccactaggtttt
gggaagctgtgccctcaccgagtggcttgcaaacgcctggtctccatgaacatgcctctg
aacagcgacgggacggtcatgttcaatgccaccctgtttgccctggtcaggacagctctg
aggatcaaaacagaagagggacccagcccatcagaggcccaccaaggggctgaggatcct
ttccgccctgcagggaacctcgaacaggccaatgaggagctgcgggccatcatcaagaag
atctggaagcggaccagcatgaagctgctggaccaggtggtgcctcctgcaggcgatgat
gaggtcaccgttggcaagttctacgccacattcctgatccaggagtacttccggaaattc
aagaagcgcaaagagcagggtcttgtgggcaaaccctcccagaggaacgcgctgtctctg
caggctggcttgcgcacgctgcacgacatcgggcctgagatccgacgggccatctccgga
gacctcaccgctgaggaggagctggacaaggccatgaaggaggctgtgtccgctgcttct
gaagatgacatcttcaggagggccggtggcctgtttggcaaccacgtcagctactaccaa
agcgacggccggagcgccttcccccagaccttcaccactcagcgcccgctgcacatcaac
aaggcgggcagcagccagggcgacactgagtcgccgtcccacgagaagctggtggactcc
accttcacccccagcagctactcgtccaccggctccaatgccaacatcaacaatgccaac
aacaccgccctgggtcgcctccctcgccctgccggctaccccagcacggtcagcactgtg
gagggccatgggccccccttgtcccctgccatccgggtgcaggaggtggcgtggaagctc
agctccaaaaggtgccactccggggagagccagacagccatggtgggtccggaggagacg
tctcaggatgagacctatgaagtgaagatgaaccatgacgcggaggcctgcagtgagccc
agcctgctctccacagacatgctgtcctaccaggatgacgaaaatcggcaactgacgctc
ccagaggaggacaagagggacatgcggcaatccccaaagaggggtttcctccgctccgcc
tcactaggtcgaagggcctccttccacctggaatgtctgaagcgacagaaggaccgaggg
ggagacatctctcagaagacagtcctgcccttgcatctggttcatcatcaggcattggca
gtggcaggcctgagccccctcctccagagaagccattcccctgcctcattccccaggcct
tttgccacccccccggccacacctggcagccgaggctggccgccacagcccatccccacc
ctgcggctggagggcgccgagtccagtgagaaactcaacagcagcttcccgtccatccac
tgcggctcctgggctgagaccacccccggtggcggggacagcaacaccacccggagagcc
cggcccgtctccctcatggtgcccagccaggctggggccccggggaggcagttccacggc
agtgccagcagcctggtggaagcggtcttgatttctgaaggactggggcagttcgctcaa
gatcccaagttcatcgaggtcaccacccaggagctggcggacgcctgcgacatgaccata
gaggagatggagagcgcggccgacaacatcctcagcgggggcgccccgcagagccccaat
ggcgccctcttaccctttgtgaactgcagggacgcggggcaggaccgagccgggggcgaa
gaggacgcgggctgtgcgcgcgcgcgggggcgcctgagcgaggaggagctccaggacagc
agggtctacgtcagcagcctgtag

DBGET integrated database retrieval system