KEGG   Macaca mulatta (rhesus monkey): 721921
Entry
721921            CDS       T01028                                 

Gene name
VCL
Definition
(RefSeq) vinculin isoform X1
  KO
K05700  vinculin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04670  Leukocyte transendothelial migration
mcc04810  Regulation of actin cytoskeleton
mcc05100  Bacterial invasion of epithelial cells
mcc05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    721921 (VCL)
   04520 Adherens junction
    721921 (VCL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    721921 (VCL)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    721921 (VCL)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    721921 (VCL)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    721921 (VCL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mcc04812]
    721921 (VCL)
   04147 Exosome [BR:mcc04147]
    721921 (VCL)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     721921 (VCL)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   721921 (VCL)
SSDB
Motif
Pfam: Vinculin I_LWEQ CARD
Other DBs
NCBI-GeneID: 721921
NCBI-ProteinID: XP_015002756
Ensembl: ENSMMUG00000020823
UniProt: F7HSL6
LinkDB
Position
9
AA seq 1134 aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKE
TVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTS
DLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQ
ELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAE
INEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKDWLHDPSAFPGDAGEQAIR
QILDEAGKVGELCAGKERREILGTCKMLGQMTDQVADLRARGQGSSPVAMQKAQQVSQGL
DVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNWLADPNGGPEGEEQIRGALAEARKIAE
LCDDPKERDDILRSLGEISALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRA
VANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGPYRQD
LLAKCDRVDQLTAQLADLAARGEGESPQARALASQLQDSLKDLKARMQEAMTQEVSDVFS
DTTTPIKLLAVAATAPPDAPNREEVFDERAANFENHSGKLGATAEKAAAVGTANKSTVEG
IQASVKTARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTK
SLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKREVENSEDPKFR
EAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEP
DFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMM
AARQLHDEARKWSSKPGIPAAEVGIGVVAEADAADAAGFPVPPDMEDDYEPELLLMPSNQ
PVNQPILAAAQSLHREATKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAK
DIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNIS
DEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ
NT seq 3405 nt   +upstreamnt  +downstreamnt
atgccggtgtttcatacgcgcacgatcgagagcatcctggagccggtggcacagcagatc
tcccacctggtgataatgcacgaggagggcgaggtggacggcaaagccattcctgacctc
accgcgcccgtggccgccgtgcaggcggccgtcagcaacctcgtccgggttggaaaagag
actgttcaaaccactgaggatcagattttgaagagagatatgccaccagcatttattaag
gtggagaatgcttgcaccaagcttgtccaggcagctcagatgcttcagtcagacccttat
tcagtgcctgctcgagactatctaattgatgggtcaaggggcatcctctctggaacatca
gacctgctccttaccttcgacgaggctgaggtccgtaaaattattagagtttgcaaagga
attttggaatatcttacagtggcagaggtggtggagactatggaagatttggtcacttac
acaaagaatcttgggccaggaatgactaagatggccaagatgattgacgagagacagcag
gagctgactcaccaggagcaccgagtgatgttggtgaactcaatgaacactgtgaaagag
ttgctgccagttctcatttcagctatgaagatttttgtgacaactaaaaactcaaaaaac
caaggcatagaggaagctttaaaaaatcgcaattttactgtggaaaaaatgagtgctgaa
attaatgagataattcgtgtgttacaactcacctcttgggatgaagatgcctgggccagc
aaggacactgaagccatgaagagagcattggcctccatagactccaaactgaaccaggcc
aaagattggctccatgaccctagtgccttcccaggggatgctggtgagcaggccatcaga
cagatcttagatgaagctggaaaagttggtgaactctgtgcaggcaaagaacgcagggag
attctgggaacttgcaaaatgctagggcagatgactgatcaagtggctgacctccgtgcc
agaggacaaggatcctcaccggtggccatgcagaaagctcagcaggtatctcagggtctt
gatgtgctcacagcaaaagtggaaaatgcagctcgcaagctggaagccatgaccaactca
aagcagagcattgcaaagaagattgatgctgctcagaactggcttgcagatccaaatggt
ggaccggaaggagaagagcagattcgaggggctttggctgaagctcggaaaatagcagaa
ttatgtgatgatcctaaagaaagagatgacattctacgttcccttggagaaatatctgct
ctgacttctaaattagcagatctacgaagacaggggaaaggagattccccagaggctcga
gccttggccaaacaggtggccacggccctacagaacctgcagaccaaaaccaaccgggct
gtggccaacagcagacccgctaaagcagctgtacaccttgagggcaagattgagcaagca
cagcggtggattgataatcccacagtggatgaccgtggagtcggtcaggctgccatccgg
gggcttgtggccgaagggcatcgtctggctaatgtaatgatggggccttatcggcaagat
cttctcgccaagtgtgaccgagtggaccagctgacagcccagctggctgacctggctgcc
agaggggaaggggagagtcctcaggcgcgagcacttgcatctcagctccaggactcctta
aaggatctaaaagctcggatgcaggaggccatgactcaggaagtgtcagatgttttcagt
gataccacaactcccatcaagctgttggcagtggcagccacggcccctcctgacgcacct
aatagggaagaggtatttgatgagagggcagctaactttgaaaaccattcaggaaagctt
ggtgctacggctgagaaggcggctgcggttggtactgctaataaatcaacagtggaaggc
attcaggcctcagtgaagacggcccgagaactcacaccccaggtggtctcggctgctcgt
atcttacttaggaaccctggaaatcaagctgcttatgaacattttgagaccatgaagaac
cagtggattgataatgttgaaaaaatgacagggctggtggacgaagccattgataccaaa
tctctgttggatgcttcggaagaagcaattaaaaaagacctggacaagtgcaaggtagct
atggccaacattcagcctcagatgctggttgctggggcaaccagcattgctcgtcgggcc
aaccggatcctgctggtggctaagagggaggtggagaattccgaggatcccaagttccgt
gaggctgtgaaagccgcctctgatgagttgagcaaaaccatctccccgatggtgatggat
gcaaaagctgtggctggaaacatttctgaccctggactgcaaaagagcttcctggactcg
ggatatcggatcctgggagctgtggccaaggtcagagaagccttccaacctcaggagcct
gacttcccgcctcctccaccagaccttgaacaactccgactaacagatgagcttgctcct
cccaaaccacctctgcctgaaggtgaggtccctccacctaggcccccaccaccagaggaa
aaggatgaagagttccctgagcagaaggccggggaggtgattaaccagccaatgatgatg
gctgccagacagctccatgatgaagctcgcaaatggtccagcaagccgggcatcccagcc
gctgaggtgggtataggtgttgtagctgaggcagatgcggccgatgctgctgggttccct
gtcccccctgacatggaagacgattacgaacctgagctgctgttaatgccatccaatcag
ccggtcaaccagcccattctggccgcggctcagtccttgcatcgggaagctaccaagtgg
tctagtaagggcaatgacatcattgcagcagccaagcgcatggctctgctgatggctgag
atgtctcggctggtaagagggggcagtggtaccaagcgggcgctcattcagtgtgccaag
gacatcgccaaggcctcagacgaggtgactcggttggccaaggaggttgccaagcagtgc
acagataaacggattagaaccaacctcttacaggtatgtgagcgaatcccaaccataagc
acccagctcaaaatcctgtccacagtgaaggccaccatgctgggccggaccaacatcagt
gatgaggagtcggagcaggccacagagatgctggttcacaacgcccagaacctcatgcag
tctgtgaaggagactgtgcgggaagcagaagctgcttcaatcaaaattcgaacagatgct
ggatttacactgcgctgggttagaaagactccctggtaccagtag

DBGET integrated database retrieval system