KEGG   Macaca mulatta (rhesus monkey): 722033
Entry
722033            CDS       T01028                                 

Gene name
TNFRSF1A
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 1A
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04064  NF-kappa B signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04150  mTOR signaling pathway
mcc04210  Apoptosis
mcc04215  Apoptosis - multiple species
mcc04217  Necroptosis
mcc04380  Osteoclast differentiation
mcc04668  TNF signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease
mcc05010  Alzheimer disease
mcc05014  Amyotrophic lateral sclerosis
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05132  Salmonella infection
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05171  Coronavirus disease - COVID-19
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    722033 (TNFRSF1A)
   04064 NF-kappa B signaling pathway
    722033 (TNFRSF1A)
   04668 TNF signaling pathway
    722033 (TNFRSF1A)
   04071 Sphingolipid signaling pathway
    722033 (TNFRSF1A)
   04150 mTOR signaling pathway
    722033 (TNFRSF1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    722033 (TNFRSF1A)
   04061 Viral protein interaction with cytokine and cytokine receptor
    722033 (TNFRSF1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    722033 (TNFRSF1A)
   04215 Apoptosis - multiple species
    722033 (TNFRSF1A)
   04217 Necroptosis
    722033 (TNFRSF1A)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    722033 (TNFRSF1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    722033 (TNFRSF1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    722033 (TNFRSF1A)
   05014 Amyotrophic lateral sclerosis
    722033 (TNFRSF1A)
   05022 Pathways of neurodegeneration - multiple diseases
    722033 (TNFRSF1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    722033 (TNFRSF1A)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    722033 (TNFRSF1A)
   04931 Insulin resistance
    722033 (TNFRSF1A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    722033 (TNFRSF1A)
   05152 Tuberculosis
    722033 (TNFRSF1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    722033 (TNFRSF1A)
   05170 Human immunodeficiency virus 1 infection
    722033 (TNFRSF1A)
   05160 Hepatitis C
    722033 (TNFRSF1A)
   05171 Coronavirus disease - COVID-19
    722033 (TNFRSF1A)
   05164 Influenza A
    722033 (TNFRSF1A)
   05168 Herpes simplex virus 1 infection
    722033 (TNFRSF1A)
   05163 Human cytomegalovirus infection
    722033 (TNFRSF1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    722033 (TNFRSF1A)
   05165 Human papillomavirus infection
    722033 (TNFRSF1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    722033 (TNFRSF1A)
   05142 Chagas disease
    722033 (TNFRSF1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    722033 (TNFRSF1A)
   04090 CD molecules [BR:mcc04090]
    722033 (TNFRSF1A)
Cytokine receptors [BR:mcc04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   722033 (TNFRSF1A)
CD molecules [BR:mcc04090]
 Proteins
  722033 (TNFRSF1A)
SSDB
Motif
Pfam: TNFR_c6 Death
Other DBs
NCBI-GeneID: 722033
NCBI-ProteinID: XP_015006371
Ensembl: ENSMMUG00000000377
UniProt: G7N5L8 H9EX53
LinkDB
Position
11
AA seq 455 aa
MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPPLRDREKRDSVCPQGKYIHPQNNSICCT
KCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD
RDTVCGCRKNQYRYYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECV
SCSNCKKTLECTKLCLPQTENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWK
SKLYAIVCGKSTPEKEGELEGTTTKPLAPTPNFSPTPGFTPTLGFSPMPSSTFTSSSTYT
PGDCPNFAASRREMAPPYLGADPILATALASAPIPTPLQKWEDSAHKPQSLETDDPATLY
AVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLEL
LGRVLRDMDLLGCLEDIEEALCGPAALPPGPGLLR
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgggcctctccaccgtgcctgacctactgctgccactggtgctcctggagctgttggtg
ggaatatacccctcaggggttattggactggtccctcccctcagggacagggagaagaga
gatagtgtgtgtccccaaggaaaatacatccaccctcaaaataattccatttgctgtacc
aagtgccacaaaggaacctacttgtacaatgactgtccaggcccggggcaggatacggac
tgcagggagtgtgagagcggctccttcaccgcttcagagaaccacctcaggcactgcctc
agctgctccaaatgccgaaaggaaatgggccaggtggagatctcttcttgcaccgtggac
cgggacaccgtgtgtggctgcaggaagaaccagtaccggtattattggagtgaaaacctt
ttccagtgcttcaattgcagcctctgcctcaatgggaccgtccacctctcctgccaggag
aaacagaataccgtgtgcacctgccatgcagggttctttctaagagaaaacgagtgtgtc
tcctgtagtaactgtaagaaaaccctggagtgcaccaagttgtgcctaccccagactgag
aatgttaagggcactgaggactcaggcaccacagtgctgttgcccctggtcatcttcttt
ggtctttgccttttatccctcctcttcattggtttaatgtatcgctaccaacggtggaag
tccaagctctacgccattgtttgtgggaaatcaacacctgaaaaagagggggagcttgaa
ggaactactactaagcccctggccccaaccccaaacttcagtcccactccaggcttcacc
cccaccctgggcttcagtcccatgcccagttccaccttcacctccagctccacctatacc
cccggtgactgtcccaacttcgcggcttcccgcagagagatggcaccaccctacctaggg
gctgaccccatccttgcaacagccctcgcctctgcccccatccccactccccttcagaag
tgggaggacagcgcccacaagccacagagcctagagactgatgaccccgcgacgctgtac
gccgtggtggagaacgtgcccccgttgcgctggaaggaattcgtgcggcgcctagggctg
agcgaccacgagatcgatcggctggagctgcagaacgggcgctgcctgcgcgaggcgcaa
tacagcatgctggcgacctggaggcggcgcacgccacgacgcgaggccacgctggagctg
ctgggccgcgtgctccgcgacatggacctgctgggttgcctggaggacatcgaggaggcg
ctgtgcggccccgccgccctcccgcccgggcccggtcttctcagatga

DBGET integrated database retrieval system