KEGG   Macaca mulatta (rhesus monkey): 722044
Entry
722044            CDS       T01028                                 

Gene name
RASGRP2
Definition
(RefSeq) RAS guanyl-releasing protein 2
  KO
K12361  RAS guanyl-releasing protein 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04062  Chemokine signaling pathway
mcc04611  Platelet activation
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    722044 (RASGRP2)
   04014 Ras signaling pathway
    722044 (RASGRP2)
   04015 Rap1 signaling pathway
    722044 (RASGRP2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    722044 (RASGRP2)
   04062 Chemokine signaling pathway
    722044 (RASGRP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    722044 (RASGRP2)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   722044 (RASGRP2)
SSDB
Motif
Pfam: RasGEF EF-hand_1 C1_1 EF-hand_6 EF-hand_7 EF-hand_5 RasGEF_N EF-hand_8
Other DBs
NCBI-GeneID: 722044
NCBI-ProteinID: NP_001248208
UniProt: H9ENK8
LinkDB
Position
14
AA seq 609 aa
MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIY
QQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IDSVPTYKWKRQVTQRNPVGQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQ
ALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEM
VSYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQC
KDRLSVECRRRAQSVSLEGSAPSPSPTHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTV
EDGVFDIHL
NT seq 1830 nt   +upstreamnt  +downstreamnt
atggcgggcactctggacctggacaagggctgcacggtggaggagctgctccgcgggtgc
atcgaagccttcgatgactccgggaaggtacgggacccgcagctggtgcgcatgttcctc
atgatgcacccctggtacatcccctcctctcagctggcggccaagctgctccacatctac
caacaatcccggaaagacaactccaattccctgcaggtgaaaacgtgccacctggtcagg
tactggatctctgccttcccggcggagtttgacttgaacccggagctggctgagcagatc
aaggagctgaaggctctgctagaccaagaagggaaccggcggcacagcagcctcatcgac
atagacagcgtccctacctacaagtggaagcggcaggtgactcagcggaaccctgtggga
cagaaaaagcgcaagatgtccttgttgtttgaccacctggagcccatggagctggcggag
catctcacctacttggagtatcgctccttctgcaagatcctgtttcaggactatcacagt
tttgtgactcacggctgcactgtggacaaccccgtcctggagcggttcatctccctcttc
aacagcgtctcgcagtgggtgcagctcatgatcctcagcaaacctacagccccgcagcgg
gccctggtcatcacacactttgtccacgtggcagagaagctgctgcagctgcagaacttc
aacacgctgatggcagtggtcgggggcctgagccacagctccatctcccgcctcaaggag
acccacagccacgttagccctgagaccatcaagctctgggagggtctcacagaactagtg
acggcgacaggcaactatggcaactaccggcgccggctggcagcctgtgtgggcttccgc
ttccctatcctgggtgtgcacctcaaggacctggtggccttgcagctggcactgcctgac
tggctggacccagcccggacccggctcaacggggccaagatgaagcagctctttagcatc
ctggaggagctggccatggtgaccagcctgcggccaccagtacaggccaaccccgacctg
ctgagcctgctcacggtgtctctggatcagtatcagacggaggatgagctgtaccaactg
tccctgcagcgggagccgcgctccaagtcctcgccaaccagccccacgagttgcacccca
ccacctcggcccccggtgctggaggagtggacctcggctgccaaacctaagctggatcag
gccctcgtggtggagcacatcgagaagatggtggagtctgtgttccggaactttgacgtc
gatggggatggccacatctcacaggaagaattccagatcatccgtgggaacttcccttac
ctcagcgcctttggggacctcgaccagaaccaggatggctgcatcagcagggaggagatg
gtgtcctatttcctgcgctccagctctgtgctggggggccgcatgggcttcgtacacaac
ttccaggagagcaactccttgcgcccggtcgcctgccgccactgcaaagccctgatcctg
ggcatctacaagcagggcctcaaatgccgagcctgtggtgtgaactgccacaagcagtgc
aaggatcgcctgtcagttgagtgtcggcgcagggcccagagtgtaagcctggaggggtct
gcaccctcaccctcacccacacacagccaccatcaccgcgccttcagcttctccctgccc
cgccctggcaggcgaggctccaggcctccagagatccgtgaggaggaggtacagaccgtg
gaggatggggtttttgacatccacttgtaa

DBGET integrated database retrieval system