KEGG   Mycobacterium canettii CIPT 140010059: MCAN_33451Help
Entry
MCAN_33451        CDS       T01585                                 

Gene name
sdhB
Definition
(GenBank) putative succinate dehydrogenase (iron-sulphur protein subunit) SDHB (succinic dehydrogenase) (fumarate reductase) (fumarate dehydrogenase) (fumaric hydrogenase)
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mce  Mycobacterium canettii CIPT 140010059
Pathway
mce00020  Citrate cycle (TCA cycle)
mce00190  Oxidative phosphorylation
mce00650  Butanoate metabolism
mce01100  Metabolic pathways
mce01110  Biosynthesis of secondary metabolites
mce01120  Microbial metabolism in diverse environments
mce01130  Biosynthesis of antibiotics
mce01200  Carbon metabolism
Module
mce_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mce_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mce_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCAN_33451 (sdhB)
   00650 Butanoate metabolism
    MCAN_33451 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MCAN_33451 (sdhB)
Enzymes [BR:mce01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MCAN_33451 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     MCAN_33451 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_18 Fer4_7 Fer4_15 Fer4 Fer4_4
Motif
Other DBs
NCBI-ProteinID: CCC45676
UniProt: G0TI57
LinkDB All DBs
Position
3770820..3771611
Genome map
AA seq 263 aa AA seqDB search
MSVEPDVETLDPPLPPVPDGAVMVTVKIARFNPDDPDAFAATGGWQSFRVPCLPSDRLLN
LLIYIKGYLDGTLTFRRSCAHGVCGSDAMRINGVNRLACKVLMRDLLPKKKGKSLTVTVE
PIRGLPVEKDLVVDMEPFFDAYRAIKPYLITSGNPPTRERIQSPTDRARYDDTTKCILCA
CCTTSCPVFWHEGSYFGPAAIVNAHRFIFDSRDEAAAERLDILNEVDGVWRCRTTFNCTE
SCPRGIEVTKAIQEVKRALMFTR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgagccggacgtcgaaactttggatccgcccctaccgccggtaccggacggc
gcggtgatggtgaccgtcaagatcgcccggttcaaccccgacgaccccgacgcgttcgcg
gccaccggcggctggcagagcttccgggtgccctgtttgcccagcgatcggctgctcaac
ctgctcatctacatcaagggctacctcgacggcacgctcaccttccggcgatcctgcgcc
catggggtgtgcggctctgatgccatgcgcatcaacggggtgaaccggctggcctgcaag
gtgctgatgcgtgacctgctgccgaagaagaagggcaaatcgttgaccgtcacggtcgag
ccgatccgcgggctaccggtggaaaaggacctggtggtcgacatggagccgttcttcgac
gcctaccgggcgatcaaaccgtacctgatcaccagcggcaacccgcccacccgcgaacgg
atccagagcccgaccgaccgcgcccgctacgacgacaccaccaagtgcatcctgtgcgcg
tgctgcaccaccagctgcccggtgttctggcacgagggcagctacttcggcccggcggcg
atcgtcaacgcgcaccgcttcatcttcgacagccgcgacgaggccgccgccgagcgcctc
gacatcctcaacgaggtcgacggggtgtggcgctgccgcaccacgttcaactgcaccgaa
tcctgcccacggggcattgaggtgaccaaggcgatccaggaggtcaagcgcgcgctgatg
ttcacccgctga

DBGET integrated database retrieval system