KEGG   Mycobacterium canettii CIPT 140010059: MCAN_37531Help
Entry
MCAN_37531        CDS       T01585                                 

Gene name
ligC
Definition
(GenBank) putative ATP-dependent DNA ligase LIGC (polydeoxyribonucleotide synthase [ATP]) (polynucleotide ligase [ATP]) (sealase) (DNA repair protein) (DNA joinase)
Organism
mce  Mycobacterium canettii CIPT 140010059
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: CCC46084
UniProt: G0TKD8
LinkDB All DBs
Position
4251179..4252255
Genome map
AA seq 358 aa AA seqDB search
MQLPVMPPVSPMLAKSVTAIPPDASYEPKWDGFRSICFRDGDQVELGSRNERPMTRYFPE
LVAAIRAELPHRCVIDGEIIIATDHGLDFEALQQRIHPAESRVRMLADRTPASFIAFDLL
ALGDDDYTGRPFSERRAALVDAVTGSGADADLSIHVTPATTDMATAQRWFSEFEGAGLDG
VIAKPPHITYQPDKRVMFKIKHLRTADCVVAGYRVHKSGSDAIGSLLLGLYQEDGQLASV
GVIGAFPMAERRRLLTELQPLVTSFDDHPWNWAAHVAGQRTPRKNEFSRWNVGKDLSFVP
LRPERVVEVRYDHMEGARFRHTAQFNRWRPDRDPRSCSYAQLERPLTVSLSDIVPGLR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcagttacccgtcatgccgccggtgtcgccgatgctggccaaatcggtcaccgcaatc
ccgccggacgcgtcgtatgaacccaaatgggacggattccgctccatctgctttcgcgac
ggtgatcaggtcgaactgggtagccgcaacgagcggccgatgacccgctacttccccgag
ctggtcgccgcgatcagggccgagctgccgcatcgctgtgtgatcgacggggagatcatc
atcgccaccgaccacggcttggacttcgaggcgctgcaacagcgcatccatcctgccgag
tcgagggtgcgaatgcttgccgaccgcacaccagcctccttcatcgcattcgacctgctg
gccctcggcgacgacgactacaccgggcggccgttcagcgaaagacgagccgctctggtc
gatgccgtaactggttcgggggccgacgctgacctgtcgatccacgtcaccccggcaacc
accgacatggcgaccgcacaacgatggttctccgagttcgagggggccggtctagacggt
gtcatcgccaaaccgccgcacatcacctatcaaccggacaaacgcgttatgttcaagatc
aaacacctgcggaccgccgattgcgtggtggccggctaccgggtgcacaagtccggcagt
gacgcgatcggctcactgctgctagggctttaccaggaggacggccaactcgcgtcggtc
ggcgtgatcggcgcgttccccatggccgaacgacgccggctattaaccgagctgcagccg
ctggtcaccagcttcgacgaccacccatggaactgggccgcccacgttgccggccagcgc
accccacgtaagaacgagttctcccgctggaatgtcggcaaagacctgtcgttcgtgccg
ctgcgacccgagcgggtggtcgaggtccgctacgaccacatggaaggcgcgcggttccgc
cacaccgcacagttcaaccggtggcgccccgaccgcgacccacgctcatgcagctatgcc
cagctcgaacgcccgctcaccgtcagcctctccgacattgtgccgggcctacgctaa

DBGET integrated database retrieval system