KEGG   Macaca fascicularis (crab-eating macaque): 101864859Help
Entry
101864859         CDS       T02918                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf03030  DNA replication
mcf03410  Base excision repair
mcf03420  Nucleotide excision repair
mcf03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101864859 (LIG1)
   03410 Base excision repair
    101864859 (LIG1)
   03420 Nucleotide excision repair
    101864859 (LIG1)
   03430 Mismatch repair
    101864859 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mcf03032]
    101864859 (LIG1)
   03400 DNA repair and recombination proteins [BR:mcf03400]
    101864859 (LIG1)
Enzymes [BR:mcf01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101864859 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     101864859 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     101864859 (LIG1)
DNA replication proteins [BR:mcf03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101864859 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101864859 (LIG1)
DNA repair and recombination proteins [BR:mcf03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101864859 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     101864859 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     101864859 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DUF1685 DDR
Motif
Other DBs
NCBI-GeneID: 101864859
NCBI-ProteinID: XP_005589781
UniProt: A0A2K5UH62
LinkDB All DBs
Position
19
AA seq 919 aa AA seqDB search
MQRSIMSFFHPKKEGKAKKPEKEASNGSRETEPPPKAALKEWNGVVSESDSPVKRPGRKA
ARVLGSEGEEEDEALSPAKGQKPAPDCSQVSPPRPATSPENNASLSDTSPTDSSPSGIPK
RRTARKQLPKRTIQEVLEEQSADEDREAKRKKEEEEVETPEESLTEAEVATEKEGEDRDQ
PTTPPKPLKTSKAETLTESVSEPEVATRQELQEEEEQTKPPRSAPKTLSSFFTPRKPAIK
KEVKEEEPGAPGKEGAAEGPLDPSGYNPAKNNYHPVEDACWKPGQKVPYLAVARTFEKIE
EVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVGDGVLLKAVAQ
ATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSKFRDIARLTGSAST
AKKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPPAV
VDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGIPL
KPMLAHPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPD
IISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF
DLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDVEQIAEFLEQSVKDSCE
GLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLL
ASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVTPDHWLDPSA
VWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQ
SQIQNQQGEDSGSDPEDTY
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatcatgtcattcttccaccccaagaaagagggtaaagcgaagaagcct
gagaaggaggcatccaacggcagcagagagacggagccccctccgaaggcggcactgaag
gagtggaatggagtggtgtccgagagtgactctccagtgaagaggccaggcaggaaggcg
gcccgggtcctgggcagcgaaggggaagaggaggatgaagcccttagccctgctaaaggc
cagaagcctgccccggactgctcacaggtctccccgccccgtcctgccacatctcctgaa
aacaacgcttccctctctgacacctctcccacggacagctccccatcagggatcccgaag
cgtcgcacagctcggaagcagctcccgaaacggaccattcaggaagtcctggaagagcag
agtgcggacgaggacagagaagccaaaaggaagaaggaggaggaagaagtggagacccca
gaagaaagcctcacagaggctgaagtggcaacagagaaggaaggagaagacagggaccag
cccaccacacctcccaagcccctaaagacctccaaagcagagaccctgacggaaagcgtt
tcggagcccgaggtggccacgaggcaggaactgcaggaggaggaagagcagaccaagcct
ccccgcagcgctcccaagacgctcagcagcttcttcacgccccggaagccagcaatcaaa
aaagaagtgaaggaggaggagccaggggctccaggaaaggagggagctgctgagggaccc
ctggacccatccggttacaatcctgccaagaacaactaccatcccgtggaagacgcctgc
tggaaaccgggccagaaggtcccttacctggccgtggcccggacgtttgagaagatcgag
gaggtgtctgcccggctccggatggtggagacactgagcaacttgctgcgctccgtggtg
gccctgtcgcctccagacctcctcccggtcctctacctcagcctcaaccaccttgggcca
ccgcagcagggcctggagcttggcgtgggtgatggcgtccttctcaaggcagtggcccag
gccacaggtcggcagctggagtctgtccgggctgaggcagccgagaagggcgacgtgggg
ctggtggccgagaacagccgcagcacccagaggctcatgctgccaccacctccgctcact
gcttccggggtcttcagcaagttccgtgacatcgccaggctcactggcagtgcttccaca
gccaagaagatagacatcatcaaaggcctctttgtggcctgccgccactcagaagcccgg
ttcatcgccaggtccctgagcggacggctgcgccttgggctggcagagcagtcggtgctg
gccgccctctcccaggctgtgagcctcacgcccccaggccaagaattcccaccagccgtg
gtagatgctgggaagggcaagacagcagaggccagaaagacgtggctggaggagcaaggc
atgatcctgaagcagacattctgcgaggtgcccgatctggaccgaattatccccgtgctg
ctggagcacggcctggaacgtctcccggagcactgcaagctgagcccagggattcccctg
aaaccaatgttggcccatcccacgcggggcgtcagtgaggtcctgaaacgctttgaggag
gcagctttcacctgcgaatacaaatacgatgggcagagggcacagatccacgccctggaa
ggcggggaggtgaagatcttcagcaggaatcaggaagacaacactggaaagtacccggac
atcatcagccgcatccccaagattaaactcccatcggtcacatccttcatcctggacact
gaagccgtggcttgggaccgggaaaagaagcagatccagccattccaagtgctcaccacc
cgcaaacgcaaggaagtggatgcgtccgagatccaggtgcaggtgtgtttgtacgccttc
gacctcatctacctcaatggagagtccctggtacgtgagcccctttcccggcgccggcag
ctgctccgggagaactttgtggagacggagggcgagtttgtcttcgccacctctctggac
accaaggacgtcgagcagatcgccgagttcctggagcagtcggtgaaagactcctgcgag
gggctgatggtgaagaccctggatgtcgatgccacctacgagatcgccaagagatcgcac
aactggctcaagctgaagaaggactaccttgatggcgtgggtgacaccctggacctggtg
gtgatcggcgcctacctgggccgggggaagcgggccggccggtacgggggcttcctgctg
gcctcctacgacgaggacagtgaggagctgcaggccatatgcaagcttggaactggcttc
agcgacgaggagctggaggagcatcaccagagcctcaaggccctggtgctgcccagcccc
cgcccttatgtgcggatagatggtgccgtgactcccgaccactggctggaccccagcgcc
gtgtgggaggtgaagtgtgccgacctctccctctcccccatctaccctgctgcgcggggc
ctggtggatagtgacaaggggatctcccttcgcttccctcggtttattcgagtccgtgaa
gacaagcagccggagcaggccaccaccagtgcacaggtggcctgtttgtaccggaagcaa
agtcagattcagaaccaacaaggcgaggactcaggctctgaccctgaagatacctactaa

DBGET integrated database retrieval system