KEGG   Macaca fascicularis (crab-eating macaque): 101865063Help
Entry
101865063         CDS       T02918                                 

Gene name
COLGALT2
Definition
(RefSeq) collagen beta(1-O)galactosyltransferase 2
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00310  Lysine degradation
mcf00514  Other types of O-glycan biosynthesis
mcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101865063 (COLGALT2)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    101865063 (COLGALT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mcf01003]
    101865063 (COLGALT2)
Enzymes [BR:mcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     101865063 (COLGALT2)
Glycosyltransferases [BR:mcf01003]
 O-Glycan biosynthesis
  O-linked Gal type
   101865063 (COLGALT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1 Glycos_transf_2 Glyco_transf_92 Aminotran_4
Motif
Other DBs
NCBI-GeneID: 101865063
NCBI-ProteinID: XP_005540276
UniProt: A0A2K5UAQ2
LinkDB All DBs
Position
1
AA seq 626 aa AA seqDB search
MAARPAATLAWSLLLLSSALLREGCRARFAAEPDSEDDGEEPVVFPESPLQSPTVLVAVL
ARNAAHTLPHFLGCLERLDYPKSRMAIWAATDHNVDNTTEILREWLKNVQRLYHYVEWRP
MDEPESYPDEIGPKHWPSSRFAHVMKLRQAALRTAREKWSDYILFIDVDNFLTNPQTLNL
LIAENKTIVAPMLESRGLYSNFWCGITPKGFYKRTPDYVQIREWKRSGCFPVPMVHSTFL
IDLRKEASDKLTFYPPHQDYTWTFDDIIVFAFSSRQAGIQMYLCNREHYGYLPIPLKSHQ
TLQEDIENLIHVQIEAMIDRPPMEPSKYVSLVPKYPDKMGFDEIFMINLKRRKDRRDRML
RTLYEQEIEVKIVEAVDGKALNTSQLKALNIEMLPGYRDPYSSRPLTRGEIGCFLSHYSV
WKEVIDRELEKTLVIEDDVRFEHQFKKKLMKLMDDIDQAQLDWELIYIGRKRMQVKEPEK
AVPNVANLVEADYSYWTLGYVISLEGAQKLVGADPFGKMLPVDEFLPIMYNKHPVAEYKE
YYESRDLKAFSAEPLLIYPTHYTGQPGYLSDTETSTIWDNETVATDWDRTHAWKSRKQSR
IYSSAKNTEALPPPTSLDTVPSRDEL
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgcgccctgccgccaccctcgcctggtcgctactgctcctctcctcagccctg
ctccgcgaaggctgccgagcgcgcttcgctgccgagccggactcggaggacgacggagag
gagccggtggttttcccggagtcgcccctgcagagccccacggtgctcgtggcggtcctc
gcccgcaacgcggcgcacacgctgccgcacttcctcggctgcctggagcggctggactac
cccaagagcaggatggccatctgggcagccaccgatcacaatgtggataatacaacagaa
atactcagggagtggctgaaaaatgtacagagactctatcactatgtcgagtggaggcct
atggatgaaccggagtcttaccctgatgaaattggaccaaagcactggccaagctcccgg
tttgcccatgtgatgaaactacgacaggcagcccttcgaactgcgagggaaaaatggtca
gactacattctgttcatagatgttgacaatttcctgactaatccacagaccctcaatcta
ctgattgcagaaaacaaaactattgtggcccccatgctggagtctcggggcctgtattct
aatttctggtgcggaatcacccctaagggcttctataagaggaccccagactacgttcag
attagagaatggaagaggtcaggctgcttccccgtccccatggtccactccaccttccta
attgacctcaggaaggaggcctcggacaagctgactttctaccccccacaccaggactac
acctggacctttgatgacatcattgtctttgccttctccagcaggcaagcaggcatccag
atgtacctctgcaacagagagcactatggctacctgcccatccccctgaagtcccatcag
acactgcaggaagacatcgagaacctcatccatgtgcagattgaagcaatgattgaccgt
cctccaatggaaccctccaagtatgtctcacttgtccctaaatatccagacaagatggga
tttgatgagattttcatgataaacctcaaacgcagaaaggacaggcgggaccggatgctg
cgcacactgtatgagcaggagattgaggtcaagattgtcgaggctgtggatggaaaggca
ctcaacacaagccagctgaaggcactgaatattgaaatgctgcctggctatcgagatccc
tattcctccaggcctctaacgaggggtgaaatcggctgctttctcagccactactcagtc
tggaaagaggtaattgatcgagagctagagaagactcttgtaattgaagacgatgtgcgt
tttgagcatcagtttaagaagaagctgatgaagctgatggatgacattgaccaggctcag
ctggactgggaactaatttatattggcaggaagaggatgcaagtaaaggaaccagagaaa
gccgtgcccaatgtggcaaacctggtcgaagccgactattcctactggaccctgggctac
gtcatctctctggaaggagcacagaagctggttggagccgatccttttgggaagatgctg
ccagtggatgagtttctgccaatcatgtacaacaagcatcctgtagctgagtacaaggag
tattatgaatccagggacctgaaagccttctctgcagaacccttgctcatctaccctacg
cactacacaggccagccggggtacctgagtgacaccgagacctccaccatctgggacaat
gagacagtggccaccgactgggataggacacatgcctggaagtcccggaagcaaagtcgt
atctacagcagtgccaagaacacagaggccctgccaccgccaacctccctggacaccgtg
ccttcgagggatgagctatga

DBGET integrated database retrieval system