KEGG   Macaca fascicularis (crab-eating macaque): 101865119Help
Entry
101865119         CDS       T02918                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00020  Citrate cycle (TCA cycle)
mcf00190  Oxidative phosphorylation
mcf01100  Metabolic pathways
mcf01200  Carbon metabolism
mcf04714  Thermogenesis
mcf04932  Non-alcoholic fatty liver disease (NAFLD)
mcf05010  Alzheimer disease
mcf05012  Parkinson disease
mcf05016  Huntington disease
Module
mcf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mcf_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101865119 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101865119 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101865119 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    101865119 (SDHB)
   05012 Parkinson disease
    101865119 (SDHB)
   05016 Huntington disease
    101865119 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101865119 (SDHB)
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101865119 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 101865119
NCBI-ProteinID: NP_001271575
UniProt: G7NUQ9
LinkDB All DBs
Position
1
AA seq 280 aa AA seqDB search
MAAVVALSLRGRLPATALGGACLQASRGAQTAAAAAPRIKKFAIYRWDPDKAGDKPHMQT
YEIDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcgcactctccttgaggggccggttaccggccacagcacttggcgga
gcctgcctgcaggcctcccgaggagcccagacagctgcagccgcagctccccgtatcaag
aaatttgccatctatcgatgggacccagacaaggctggagacaaacctcatatgcagact
tacgaaattgaccttaataaatgtggccccatggtattggatgctttaatcaagattaag
aatgaaattgactctactttgaccttccgaagatcatgcagagaaggcatctgtgggtct
tgtgcaatgaacatcaatggaggcaacactctagcttgcacccgaaggattgacaccaac
ctcaataaggtctcaaaaatctaccctcttccgcatatgtatgtgataaaggaccttgtt
cccgatttgagcaacttctatgctcagtacaaatccattgagccttatttgaagaagaag
gatgaatctcaggaaggcaagcagcagtatctgcagtccatagaagagcgtgagaaactg
gacgggctctacgagtgcattctctgtgcctgctgtagcaccagctgccccagctactgg
tggaacggagacaaatatctggggcctgcagttcttatgcaggcctatcgctggatgatt
gactccagagacgacttcacagaggagcgcctggccaagctgcaggacccgttctctcta
taccgctgccacaccatcatgaactgcacaaggacctgtcctaagggtctgaatccaggg
aaagctattgcggaaatcaagaaaatgatggcaacctataaggagaagaaagcttcagtt
taa

DBGET integrated database retrieval system