KEGG   Macaca fascicularis (crab-eating macaque): 101865175
Entry
101865175         CDS       T02918                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04010  MAPK signaling pathway
mcf04020  Calcium signaling pathway
mcf04022  cGMP-PKG signaling pathway
mcf04024  cAMP signaling pathway
mcf04260  Cardiac muscle contraction
mcf04261  Adrenergic signaling in cardiomyocytes
mcf04270  Vascular smooth muscle contraction
mcf04713  Circadian entrainment
mcf04720  Long-term potentiation
mcf04723  Retrograde endocannabinoid signaling
mcf04724  Glutamatergic synapse
mcf04725  Cholinergic synapse
mcf04726  Serotonergic synapse
mcf04727  GABAergic synapse
mcf04728  Dopaminergic synapse
mcf04742  Taste transduction
mcf04911  Insulin secretion
mcf04912  GnRH signaling pathway
mcf04921  Oxytocin signaling pathway
mcf04924  Renin secretion
mcf04925  Aldosterone synthesis and secretion
mcf04927  Cortisol synthesis and secretion
mcf04929  GnRH secretion
mcf04930  Type II diabetes mellitus
mcf04934  Cushing syndrome
mcf04935  Growth hormone synthesis, secretion and action
mcf05010  Alzheimer disease
mcf05020  Prion disease
mcf05022  Pathways of neurodegeneration - multiple diseases
mcf05031  Amphetamine addiction
mcf05410  Hypertrophic cardiomyopathy
mcf05412  Arrhythmogenic right ventricular cardiomyopathy
mcf05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101865175
   04020 Calcium signaling pathway
    101865175
   04024 cAMP signaling pathway
    101865175
   04022 cGMP-PKG signaling pathway
    101865175
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101865175
   04929 GnRH secretion
    101865175
   04912 GnRH signaling pathway
    101865175
   04921 Oxytocin signaling pathway
    101865175
   04935 Growth hormone synthesis, secretion and action
    101865175
   04924 Renin secretion
    101865175
   04925 Aldosterone synthesis and secretion
    101865175
   04927 Cortisol synthesis and secretion
    101865175
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101865175
   04261 Adrenergic signaling in cardiomyocytes
    101865175
   04270 Vascular smooth muscle contraction
    101865175
  09156 Nervous system
   04724 Glutamatergic synapse
    101865175
   04727 GABAergic synapse
    101865175
   04725 Cholinergic synapse
    101865175
   04728 Dopaminergic synapse
    101865175
   04726 Serotonergic synapse
    101865175
   04720 Long-term potentiation
    101865175
   04723 Retrograde endocannabinoid signaling
    101865175
  09157 Sensory system
   04742 Taste transduction
    101865175
  09159 Environmental adaptation
   04713 Circadian entrainment
    101865175
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101865175
   05020 Prion disease
    101865175
   05022 Pathways of neurodegeneration - multiple diseases
    101865175
  09165 Substance dependence
   05031 Amphetamine addiction
    101865175
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101865175
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101865175
   05414 Dilated cardiomyopathy
    101865175
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101865175
   04934 Cushing syndrome
    101865175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcf04040]
    101865175
Ion channels [BR:mcf04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101865175
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 101865175
NCBI-ProteinID: XP_015285716
LinkDB
Position
11
AA seq 1893 aa
MVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGR
QCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVY
FVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQA
EDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSR
YWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALL
ALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGILETILVETKIMSPLGISVLRCVRL
LRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQT
RRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYIL
LNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEMVEKPAVEESKEEKI
ELKSITADGESPPTTKINMDDLQPNENEDKSPYPNPETTGEEDEEEPEMPVGPRPRPLSE
LHLKEKAVPMPEASAFFVFSSNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQ
HTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF
GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFA
CIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAA
MMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGF
VIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYL
MFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKHYFCDAWN
TFDALIVVGSIVDIAITEVNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGE
GIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQ
AVLLLFRCATGEAWQDIMLACMPGKKCAPESEPGNSTEGETPCGSSFAVFYFISFYMLCA
FLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRI
QPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEEGPSPSEAH
QGAEDPFRPAGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQ
EYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKE
AVSAASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKAGSSQGDTESPSH
EKLVDSTFTPSSYSSTGSNANINNANNTALGRLPRPAGYPSTVSTVEGHGPPLSPAIRVQ
EVAWKLSSKRCHSGESQTAMVGPEETSQDETYEVKMNHDAEACSEPSLLSTDMLSYQDDE
NRQLTLPEEDKRDMRQSPKRGFLRSASLGRRASFHLECLKRQKDRGGDISQKTVLPLHLV
HHQALAVAGLSPLLQRSHSPASFPRPFATPPATPGSRGWPPQPIPTLRLEGAESSEKLNS
SFPSIHCGSWAETTPGGGDSNTTRRARPVSLMVPSQAGAPGRQFHGSASSLVEAVLISEG
LGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAGQ
DRAGGEEDAGCARARGRLSEEELQDSRVYVSSL
NT seq 5682 nt   +upstreamnt  +downstreamnt
atggtccccctgctgcacatcgccctgctcgtgctgtttgtcatcatcatctatgccatc
atcggcctggagctcttcatggggaagatgcacaagacctgctacaaccaggagggcata
gcagatgttccagcagaagatgacccttccccttgtgcgctggaaacaggccatgggcgg
cagtgccagaacggcacggtgtgcaagcccggctgggatggtcccaagcacggcatcacc
aactttgacaactttgccttcgccatgctcacggtgttccagtgcatcaccatggagggc
tggacggacgtgctgtactggatgcaggacgctatgggctatgagttaccctgggtgtat
tttgtcagtctggtcatctttggatcctttttcgttctaaatctggttctcggtgtgttg
agcggagagttttccaaagagagggagaaggccaaggcccggggagatttccagaagctg
cgggagaagcagcagctggaagaggatctcaaaggctacctggactggatcactcaggcc
gaagacatcgatcccgagaacgaggacgaaggcatggatgaggagaagccccgaaacatg
agcatgcccaccagtgagaccgagtccgtcaacaccgaaaacgtggctggaggtgacatc
gagggagaaaactgcggggccaggctggcccaccggatctccaagtcaaagttcagccgc
tactggcgccggtggaatcggttctgcagaagaaagtgccgtgccgcggtcaagtctaat
gtcttctactggctggtgattttcctggtgttcctcaacacgctcaccattgcctctgag
cactacaaccagccccactggctcacggaagtccaagacacggcgaacaaggccctgctg
gcgctgttcacggcagagatgctcctgaagatgtacagcctgggcctgcaggcctacttc
gtgtccctcttcaaccgctttgactgcttcgtcgtgtgtggcggcatcctggagaccatc
ctggtagagaccaagatcatgtccccactgggcatctccgtgctccgatgcgtccggttg
ctgaggatattcaagatcacgaggtactggaactccttgagcaacctggtggcatccttg
ctgaactctgtgcgctccatcgcctccctgctccttctcctattcctcttcatcatcatc
ttctccctcctggggatgcagctctttggaggaaagttcaactttgatgagatgcagacc
cggaggagcacatttgataacttcccccagtccctcctcactgtgtttcagatcctgacc
ggggaggactggaattcggtgatgtatgatgggatcatggcttatggcggcccctctttt
ccagggatgttagtctgtatttacttcatcatcctcttcatctgtggaaactatatccta
ctgaatgtgttcttggccattgctgtggacaacctggctgacgctgagagcctcacatct
gcccaaaaggaggaggaagaggagaaggagagaaagaagctggccaggactgccagccca
gagaagaaacaagagatggtggagaagccggcagtggaggaatccaaggaggagaagatt
gagctgaaatccatcacggctgacggagagtctccacccaccaccaagatcaacatggat
gacctccagcccaatgaaaatgaggataagagcccctaccccaacccagagactacagga
gaagaggatgaggaggagccagagatgcctgtcggccctcgcccacgcccactctctgag
cttcaccttaaggaaaaggcagtgcccatgccagaagccagtgcgtttttcgtcttcagc
tctaacaacaggtttcgcctgcagtgccaccgcattgtcaacgacacgatcttcaccaac
ctgatcctcttcttcattctgctcagcagcatttccctggctgctgaggacccggtccag
cacacctccttcaggaaccatatcctaggcaatgcagactatgtcttcactagtatcttt
acattagaaattatccttaagatgactgcttatggggcttttctgcacaagggctccttc
tgccggaactacttcaacatcctggacctgctggtggtcagcgtgtccctcatctccttt
ggcatccagtccagtgcaatcaatgtcgtgaagatcttgcgagtcctgcgagtactcagg
cccctgagggctatcaacagggccaaggggctaaagcatgtggttcagtgtgtgtttgtc
gccatccggaccatcgggaacatcgtgattgtcaccaccctgctgcagttcatgttcgcc
tgcatcggggtccagctcttcaagggaaagctgtacacctgttcagacagttccaagcag
acagaggcggaatgcaagggcaactacatcacgtacaaagacggggaggttgaccacccc
atcatccaaccccgcagctgggagaacagcaagtttgactttgacaatgttctggccgcc
atgatggccctcttcaccgtctccaccttcgaagggtggccagagctgctgtaccgctcc
atcgactcccacaccgaagacaagggtcccatctacaattaccgcgtggagatctccatc
ttcttcatcatctacatcatcatcatcgccttcttcatgatgaacatcttcgtgggcttc
gtcatcgtcaccttccaggagcagggggagcaggagtacaagaactgtgagctggacaag
aaccagcgacagtgtgtggaatacgccctcaaggcccggcccctgcggaggtacatcccc
aagaaccagcaccagtacaaagtgtggtacgtggtcaactccacctacttcgagtacctg
atgttcgtcctcatcctgctcaacaccatctgcctggccatgcagcactacggccagagc
tgcctgttcaaaatcgccatgaacatcctcaacatgctcttcactggcctcttcaccgtg
gagatgatcctgaagctcattgccttcaaacccaagcactatttctgtgatgcatggaat
acatttgacgccttgattgttgtgggtagcattgttgatatagcaatcaccgaggtaaac
ccagctgaacatacccaatgctctccctctatgaacgcagaggaaaactcgcgcatctcc
atcaccttcttccgcctattccgggtcatgcgcctggtgaagctgctgagccgcggggag
ggcatccggacgctgctgtggaccttcatcaagtccttccaggccctgccctatgtggcc
ctcctgatcgtgatgctgttcttcatctacgcggtgatcgggatgcaggtgtttgggaaa
attgccctgaatgataccacagagatcaaccggaacaacaactttcagaccttcccccag
gccgtgctgctcctcttcaggtgtgccactggggaggcctggcaggacatcatgctggcc
tgcatgccaggcaagaagtgtgccccggagtccgagcccggcaacagcacggagggtgag
acaccctgtggcagcagctttgccgtcttctacttcatcagcttctacatgctctgtgcc
ttcctgatcatcaacctctttgtagctgtcatcatggacaactttgactacctgacaagg
gactggtccatccttggtccccaccacctggatgagtttaaaagaatctgggcagagtat
gaccctgaagccaagggtcgtatcaaacacctggatgtggtgaccctcctccggcggatt
cagcccccactaggttttgggaagctgtgccctcaccgagtggcttgcaaacgcctggtc
tccatgaacatgcctctgaacagcgacgggacggtcatgttcaatgccaccctgtttgcc
ctggtcaggacagctctgaggatcaaaacagaagagggacccagcccatcagaggcccac
caaggggctgaggatcctttccgccctgcagggaacctcgaacaggccaatgaggagctg
cgggccatcatcaagaagatctggaagcggaccagcatgaagctgctggaccaggtggtg
cctcctgcaggcgatgatgaggtcaccgttggcaagttctatgccacattcctgatccag
gagtacttccggaaattcaagaagcgcaaagagcagggtcttgtgggcaaaccctcccag
aggaacgcgctgtctctgcaggctggcttgcgcacgctgcacgacatcgggcctgagatc
cgacgggccatctccggagacctcaccgctgaggaggagctggacaaggccatgaaggag
gctgtgtccgctgcttctgaagatgacatcttcaggagggccggtggcctgtttggcaac
cacgtcagctactaccaaagcgacggccggagcgccttcccccagaccttcaccactcag
cgcccgctgcacatcaacaaggcgggcagcagccagggcgacactgagtcgccgtcccac
gagaagctggtggactccaccttcacccccagcagctactcgtccaccggctccaatgcc
aacatcaacaatgccaacaacaccgccctgggtcgcctccctcgccctgccggctacccc
agcacggtcagcactgtggagggccatgggccccccttgtcccctgccatccgggtgcag
gaggtggcgtggaagctcagctccaaaaggtgccactccggggagagccagacagccatg
gtgggtccggaggagacgtctcaggatgagacctatgaagtgaagatgaaccatgacgcg
gaggcctgcagtgagcccagcctgctctccacagacatgctgtcctaccaggatgacgaa
aatcggcaactgacgctcccagaggaggacaagagggacatgcggcaatccccaaagagg
ggtttcctccgctccgcctcactgggtcgaagggcctccttccacctggaatgtctgaag
cgacagaaggaccgagggggagacatctctcagaagacagtcctgcccttgcatctggtt
catcatcaggcattggcagtggcaggcctgagccccctcctccagagaagccattcccct
gcctcattccccaggccttttgccacccccccggccacacctggcagccgaggctggccg
ccacagcccatccccaccctgcggctggagggcgccgagtccagtgagaaactcaacagc
agcttcccgtccatccactgcggctcctgggctgagaccacccccggtggcggggacagc
aacaccacccggagagcccggcccgtctccctcatggtgcccagccaggctggggccccg
gggaggcagttccacggcagtgccagcagcctggtggaagcggtcttgatttctgaagga
ctggggcagttcgctcaagatcccaagttcatcgaggtcaccacccaggagctggcggac
gcctgcgacatgaccatagaggagatggagagcgcggccgacaacatcctcagcgggggc
gccccgcagagccccaatggcgccctcttaccctttgtgaactgcagggacgcggggcag
gaccgagccgggggcgaagaggacgcgggctgtgcgcgcgcgcgggggcgcctgagcgag
gaggagctccaggacagcagggtctacgtcagcagcctgtag

DBGET integrated database retrieval system