KEGG   Macaca fascicularis (crab-eating macaque): 101865893Help
Entry
101865893         CDS       T02918                                 

Gene name
PARK7
Definition
(RefSeq) Parkinsonism associated deglycase
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05012 Parkinson disease
    101865893 (PARK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mcf01002]
    101865893 (PARK7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    101865893 (PARK7)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     101865893 (PARK7)
Peptidases [BR:mcf01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   101865893 (PARK7)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101865893 (PARK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI GATase_3 ThiJ_like
Motif
Other DBs
NCBI-GeneID: 101865893
NCBI-ProteinID: NP_001271615
UniProt: I7GJ98
LinkDB All DBs
Position
1
AA seq 153 aa AA seqDB search
MASKRALVILAKGAEEMETVIPVDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQE
NRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSR
GPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaaagagctctggtcatcctggctaaaggagcagaggaaatggagacggtc
atccctgtagatgcaaaaaaagagggaccgtatgatgtggtggttctaccaggaggtaat
ctgggtgcacagaatttatctgagtctgctgccgtgaaggagatactgaaggagcaggaa
aaccggaagggcctgatagccgccatctgtgcaggtcctactgctcttttggctcatgaa
ataggttttggaagtaaagttaccacacaccctcttgctaaagacaaaatgatgaatgga
ggtcattacacctactctgagaatcgtgtggaaaaggacggcctgattcttacaagccgg
gggcctgggaccagctttgagtttgcacttgcaattgttgaagccctgaacggcaaggag
gtggcggctcaagtgaaggctccacttgttcttaaagactag

DBGET integrated database retrieval system