KEGG   Macaca fascicularis (crab-eating macaque): 101866288Help
Entry
101866288         CDS       T02918                                 

Gene name
PRSS2
Definition
(RefSeq) protease, serine 2
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04080  Neuroactive ligand-receptor interaction
mcf04972  Pancreatic secretion
mcf04974  Protein digestion and absorption
mcf05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101866288 (PRSS2)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    101866288 (PRSS2)
   04974 Protein digestion and absorption
    101866288 (PRSS2)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    101866288 (PRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mcf01002]
    101866288 (PRSS2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    101866288 (PRSS2)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     101866288 (PRSS2)
Peptidases [BR:mcf01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101866288 (PRSS2)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101866288 (PRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 101866288
NCBI-ProteinID: XP_005551066
LinkDB All DBs
Position
3
AA seq 261 aa AA seqDB search
MHMRETNVFTLKKGRSAPLVFHPPDALIAAPFDDDDKIVGGYTCEENSVPYQVSLNSGYH
FCGGSLINEQWVVSAAHCYKTRIQVRLGEHNIEVLEGTEQFINAAKIIRHPDYDRKTLNN
DILLIKLSSPAVINARVSTISLPTAPPAAGAEALISGWGNTLSSGADYPDELQCLEAPVL
SQAECEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVSNGQLQGIVSWGYGCAQKNRP
GVYTKVYNYVDWIRDTIAANS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcacatgagagagacaaatgtcttcacattgaagaaggggaggagtgcgccactggtt
ttccatcctccagatgcactgattgctgccccctttgacgatgatgacaagatcgttggg
ggctacacctgtgaagagaattctgtcccctaccaggtgtctctgaattctggctaccac
ttctgtggtggctccctcataaacgaacagtgggtggtgtcagcagctcactgctacaag
acccgcatccaggtgagactgggagagcacaacatcgaagtcctggaggggactgagcag
ttcatcaatgcagccaagatcatccgccacccagattacgacaggaaaactctgaacaat
gacatcctgctgatcaagctctcctcacctgccgtcatcaatgcccgtgtgtccaccatc
tctctgcccactgcccctccagctgctggcgccgaggccctcatctctggctggggcaac
actctgagctctggcgccgactacccagatgagctgcagtgcctggaagcgcctgtgctg
tcccaggctgagtgtgaagcctcctaccctggaaagattaccagcaacatgttctgtgtg
ggcttccttgaaggaggcaaggattcctgccagggtgactctggtggccctgtggtctcc
aatggacagctccaaggaattgtctcctggggctatggctgtgcccagaagaacaggcct
ggagtctacaccaaggtctacaactatgtggactggattagggacaccatagctgccaac
agctaa

DBGET integrated database retrieval system