KEGG   Macaca fascicularis (crab-eating macaque): 101867324
Entry
101867324         CDS       T02918                                 

Gene name
RELA
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01523  Antifolate resistance
mcf04010  MAPK signaling pathway
mcf04014  Ras signaling pathway
mcf04024  cAMP signaling pathway
mcf04062  Chemokine signaling pathway
mcf04064  NF-kappa B signaling pathway
mcf04066  HIF-1 signaling pathway
mcf04071  Sphingolipid signaling pathway
mcf04137  Mitophagy - animal
mcf04151  PI3K-Akt signaling pathway
mcf04210  Apoptosis
mcf04211  Longevity regulating pathway
mcf04218  Cellular senescence
mcf04380  Osteoclast differentiation
mcf04620  Toll-like receptor signaling pathway
mcf04621  NOD-like receptor signaling pathway
mcf04622  RIG-I-like receptor signaling pathway
mcf04623  Cytosolic DNA-sensing pathway
mcf04625  C-type lectin receptor signaling pathway
mcf04657  IL-17 signaling pathway
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04660  T cell receptor signaling pathway
mcf04662  B cell receptor signaling pathway
mcf04668  TNF signaling pathway
mcf04722  Neurotrophin signaling pathway
mcf04917  Prolactin signaling pathway
mcf04920  Adipocytokine signaling pathway
mcf04926  Relaxin signaling pathway
mcf04931  Insulin resistance
mcf04932  Non-alcoholic fatty liver disease
mcf04933  AGE-RAGE signaling pathway in diabetic complications
mcf05010  Alzheimer disease
mcf05022  Pathways of neurodegeneration - multiple diseases
mcf05030  Cocaine addiction
mcf05132  Salmonella infection
mcf05133  Pertussis
mcf05134  Legionellosis
mcf05135  Yersinia infection
mcf05140  Leishmaniasis
mcf05142  Chagas disease
mcf05145  Toxoplasmosis
mcf05146  Amoebiasis
mcf05152  Tuberculosis
mcf05160  Hepatitis C
mcf05161  Hepatitis B
mcf05162  Measles
mcf05163  Human cytomegalovirus infection
mcf05164  Influenza A
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05200  Pathways in cancer
mcf05202  Transcriptional misregulation in cancer
mcf05203  Viral carcinogenesis
mcf05212  Pancreatic cancer
mcf05215  Prostate cancer
mcf05220  Chronic myeloid leukemia
mcf05221  Acute myeloid leukemia
mcf05222  Small cell lung cancer
mcf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcf05321  Inflammatory bowel disease
mcf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101867324 (RELA)
   04014 Ras signaling pathway
    101867324 (RELA)
   04064 NF-kappa B signaling pathway
    101867324 (RELA)
   04668 TNF signaling pathway
    101867324 (RELA)
   04066 HIF-1 signaling pathway
    101867324 (RELA)
   04071 Sphingolipid signaling pathway
    101867324 (RELA)
   04024 cAMP signaling pathway
    101867324 (RELA)
   04151 PI3K-Akt signaling pathway
    101867324 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101867324 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    101867324 (RELA)
   04218 Cellular senescence
    101867324 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101867324 (RELA)
   04621 NOD-like receptor signaling pathway
    101867324 (RELA)
   04622 RIG-I-like receptor signaling pathway
    101867324 (RELA)
   04623 Cytosolic DNA-sensing pathway
    101867324 (RELA)
   04625 C-type lectin receptor signaling pathway
    101867324 (RELA)
   04660 T cell receptor signaling pathway
    101867324 (RELA)
   04658 Th1 and Th2 cell differentiation
    101867324 (RELA)
   04659 Th17 cell differentiation
    101867324 (RELA)
   04657 IL-17 signaling pathway
    101867324 (RELA)
   04662 B cell receptor signaling pathway
    101867324 (RELA)
   04062 Chemokine signaling pathway
    101867324 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101867324 (RELA)
   04917 Prolactin signaling pathway
    101867324 (RELA)
   04926 Relaxin signaling pathway
    101867324 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101867324 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101867324 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    101867324 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101867324 (RELA)
   05202 Transcriptional misregulation in cancer
    101867324 (RELA)
   05203 Viral carcinogenesis
    101867324 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101867324 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101867324 (RELA)
   05221 Acute myeloid leukemia
    101867324 (RELA)
   05220 Chronic myeloid leukemia
    101867324 (RELA)
   05215 Prostate cancer
    101867324 (RELA)
   05222 Small cell lung cancer
    101867324 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101867324 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101867324 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    101867324 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    101867324 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101867324 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101867324 (RELA)
   04931 Insulin resistance
    101867324 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101867324 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101867324 (RELA)
   05135 Yersinia infection
    101867324 (RELA)
   05133 Pertussis
    101867324 (RELA)
   05134 Legionellosis
    101867324 (RELA)
   05152 Tuberculosis
    101867324 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101867324 (RELA)
   05170 Human immunodeficiency virus 1 infection
    101867324 (RELA)
   05162 Measles
    101867324 (RELA)
   05164 Influenza A
    101867324 (RELA)
   05161 Hepatitis B
    101867324 (RELA)
   05160 Hepatitis C
    101867324 (RELA)
   05168 Herpes simplex virus 1 infection
    101867324 (RELA)
   05163 Human cytomegalovirus infection
    101867324 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101867324 (RELA)
   05169 Epstein-Barr virus infection
    101867324 (RELA)
   05165 Human papillomavirus infection
    101867324 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101867324 (RELA)
   05145 Toxoplasmosis
    101867324 (RELA)
   05140 Leishmaniasis
    101867324 (RELA)
   05142 Chagas disease
    101867324 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101867324 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcf03000]
    101867324 (RELA)
Transcription factors [BR:mcf03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    101867324 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 101867324
NCBI-ProteinID: XP_005577305
UniProt: A0A2K5V7Y3
LinkDB
Position
14
AA seq 544 aa
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAITQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSVVPKPAPQPYPFTSSLSTINYD
EFPTMVFPSGQISQASALAPPQVLPQAPAPAPAPAMVSPLAQAPVLAPGPPQAVAPPAPK
PTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPTVFTDLASVDNSEFQQLLNQGVPVAPH
TTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLS
QISS
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggacgaactgttccccctcatcttcccggcagagccagcccaggcctctggcccttat
gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg
cgctccgcgggcagcatcccaggcgagaggagcacagataccaccaagacccaccccacc
atcaagatcaatggctacacaggaccagggacagtacgcatctccctagtcaccaaggac
cctcctcaccggcctcacccccacgagcttgtaggaaaggactgccgggatggcttctat
gaggctgagctctgcccggaccgctgcatccacagtttccagaacctgggaatccagtgt
gtgaagaagcgggacctggagcaggctatcactcagcgcatccagacgaacaacaatccc
ttccaagttcctatagaagaacagcgtggggactacgacctgaatgctgtgcggctctgc
ttccaggtgacagtgcgggatccatcaggcaggcccctccgcctgccgcctgtcctttct
catcccatctttgacaaccgtgcccccaacactgccgaactcaagatctgccgagtgaac
cgaaactctggcagctgcctcggtggggatgagatcttcctactgtgtgacaaggtgcag
aaagaggacattgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttca
caagctgatgtgcaccgacaagtggccattgtgttccggacccctccctacgcagacccc
agcctgcaggctcccgtgcgtgtctccatgcagctgcggcggccttccgaccgggagctc
agtgagcccatggaattccagtacctgccagatacagacgatcgtcaccggattgaggag
aaacgcaaaaggacatatgagaccttcaagagcatcatgaagaagagtcctttcagcgga
cccactgacccccggcctccacctcggcgcattgctgtgccttcccgcagctcagttgtt
cccaagccagcaccccagccctatccctttacgtcatccctgagcaccatcaactatgat
gagtttcccaccatggtgtttccttctgggcagataagccaggcctcagccttggcccct
ccccaagtcctgccccaggctccagcccctgcccctgctccagccatggtatcacctctg
gcccaggccccagtcctagccccaggccctcctcaggctgtggccccacctgcccccaag
cccacccaggctggggaaggaacgctgtcagaggccttgctgcagctgcagtttgatgat
gaagacctgggggccttgcttggcaacagcacagacccaaccgtgttcacagacctggca
tcagtcgacaactccgagtttcagcagctgctgaaccagggcgtacctgtggccccccac
acaactgagcccatgctgatggagtaccctgaggctataactcgcctagtgacaggggcc
cagaggccccctgacccagctcctgctccactgggggccccggggctccccaacggcctc
ctttcaggagatgaagacttctcctccattgcggacatggacttctcagccctgctgagt
cagatcagctcctaa

DBGET integrated database retrieval system