KEGG   Macaca fascicularis (crab-eating macaque): 101925732Help
Entry
101925732         CDS       T02918                                 

Gene name
MAPK6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    101925732 (MAPK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcf01001]
    101925732 (MAPK6)
Enzymes [BR:mcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101925732 (MAPK6)
Protein kinases [BR:mcf01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101925732 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 101925732
NCBI-ProteinID: XP_005559633
UniProt: A0A2K5U6X6
LinkDB All DBs
Position
7
AA seq 726 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCEPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTD
PQSVKHALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDL
ANVLEQGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLA
RIMDPHYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGA
HELEQMQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQ
ILTFSPMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWE
RYHDCQFSEHDWPIHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAF
DTSYSTEPCWQYSDHHENKYCDLECSHTCNYKTRSSSYLDNLVWRESEVNHYYEPKLIID
LSNWKEQSKEKSDKKGKSKCERNGLVKAQIALEEASQQLAGKEREKNQGFDFDSFIAGTI
QLSSQHEPTDVVDKLNDLNSSVSQLELKSLISKSVSQEKQEKGMANLAQLEALYQSSWDS
QFVSGGEDCFFINQFCEVRKDEQVEKENTYTSYLDKFFSRKEDTEMLETEPVEDGKLGER
GHEAGFLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSS
ILKHLN
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagtttgaaagtctcatgaacattcatggttttgatctgggttctaggtat
atggacttaaaaccattgggttgtgaaccattgggttgtggaggcaatggcttggttttt
tctgctgtagacaatgactgtgacaaaagagtagccatcaagaaaattgtccttactgat
ccccagagtgtcaaacatgctctacgtgaaatcaaaattattagaagacttgaccatgat
aacattgtgaaagtgtttgaaattcttggtcctagtggaagccaattaacagacgatgtg
ggctctcttacggaactgaacagtgtttacattgttcaggagtacatggagacagacttg
gctaatgtgctggagcagggccctttactggaagagcatgccaggctgttcatgtatcag
ctgctacgggggctcaagtatattcactctgcaaacgtactgcacagagatctcaaacca
gctaatcttttcattaatactgaagacttggtgctgaagataggtgactttggtcttgca
cggatcatggatcctcattattcccataagggtcatctttctgaaggattggttactaaa
tggtacagatctccacgtcttttactttctcctaataattatactaaagccattgacatg
tgggctgcaggctgcatctttgctgaaatgctgactggtaaaaccctttttgcaggtgca
catgaacttgaacagatgcagctgattttagaatctattcctgttgtacatgaggaagat
cgtcaggagcttctcagcgtaattccagtttacattagaaatgacatgactgagccacac
aaacctttaactcagctgcttccaggaattagtcgagaagcactggatttcctggaacaa
attttgacatttagtcccatggatcggttaacagcagaagaagcgctctcccatccttac
atgagcatatattcttttccaatggatgagccaatttcaagccatccttttcatattgaa
gatgaagttgatgatattttgcttatggatgaaactcacagtcacatttataactgggaa
aggtatcatgattgtcagttttcagagcatgattggcctatacataacaactttgatatt
gatgaggttcagcttgatccaagagctctgtccgatgtcactgatgaagaagaagtacaa
gttgatccccgaaaatatttggatggagatcgggaaaagtatctagaggatcctgctttt
gataccagttactctactgagccttgttggcaatactcagatcatcatgaaaacaaatat
tgtgatctggagtgtagccatacttgtaactacaaaacgaggtcgtcatcatatttagat
aacttagtttggagagagagtgaagttaaccattactatgaacccaagcttattatagat
ctttccaattggaaagaacaaagcaaagaaaaatctgataagaaaggcaaatcaaaatgt
gaaaggaatggattggttaaagcccagatagcgctagaggaagcatcacagcaactggct
ggaaaagaaagggaaaagaatcagggatttgattttgattcctttattgcaggaactatt
caacttagttcccaacatgagcctactgatgttgttgataaattaaatgacttgaatagc
tcagtgtcccaactagaattgaaaagtttgatatcaaagtcagtaagccaggaaaaacag
gaaaaaggaatggcaaatctggctcaattagaagccttgtaccaatcttcttgggacagc
cagtttgtgagtggtggggaggactgttttttcatcaatcagttttgtgaggtaaggaag
gatgaacaagttgagaaggaaaacacttacactagttacttggacaagttctttagcagg
aaagaagatactgaaatgctagaaactgagccagtagaggatgggaagcttggggagaga
ggacatgaggcaggatttctgaacaacagtggggagttcctcttcaacaagcagcttgag
tccataggcatcccgcagtttcacagtccagttgggtcaccacttaagtcaatacaggcc
acattaacaccttctgctatgaaatcttcccctcaaattcctcataaaacatacagcagc
attctgaaacatctgaactaa

DBGET integrated database retrieval system