KEGG   Macaca fascicularis (crab-eating macaque): 101925741
Entry
101925741         CDS       T02918                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00230  Purine metabolism
mcf01100  Metabolic pathways
mcf01522  Endocrine resistance
mcf04015  Rap1 signaling pathway
mcf04020  Calcium signaling pathway
mcf04022  cGMP-PKG signaling pathway
mcf04024  cAMP signaling pathway
mcf04062  Chemokine signaling pathway
mcf04072  Phospholipase D signaling pathway
mcf04114  Oocyte meiosis
mcf04211  Longevity regulating pathway
mcf04213  Longevity regulating pathway - multiple species
mcf04261  Adrenergic signaling in cardiomyocytes
mcf04270  Vascular smooth muscle contraction
mcf04371  Apelin signaling pathway
mcf04540  Gap junction
mcf04611  Platelet activation
mcf04713  Circadian entrainment
mcf04714  Thermogenesis
mcf04723  Retrograde endocannabinoid signaling
mcf04724  Glutamatergic synapse
mcf04725  Cholinergic synapse
mcf04727  GABAergic synapse
mcf04740  Olfactory transduction
mcf04750  Inflammatory mediator regulation of TRP channels
mcf04911  Insulin secretion
mcf04912  GnRH signaling pathway
mcf04913  Ovarian steroidogenesis
mcf04914  Progesterone-mediated oocyte maturation
mcf04915  Estrogen signaling pathway
mcf04916  Melanogenesis
mcf04918  Thyroid hormone synthesis
mcf04921  Oxytocin signaling pathway
mcf04923  Regulation of lipolysis in adipocytes
mcf04925  Aldosterone synthesis and secretion
mcf04926  Relaxin signaling pathway
mcf04927  Cortisol synthesis and secretion
mcf04928  Parathyroid hormone synthesis, secretion and action
mcf04934  Cushing syndrome
mcf04935  Growth hormone synthesis, secretion and action
mcf04962  Vasopressin-regulated water reabsorption
mcf04970  Salivary secretion
mcf04971  Gastric acid secretion
mcf04972  Pancreatic secretion
mcf04976  Bile secretion
mcf05032  Morphine addiction
mcf05163  Human cytomegalovirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05200  Pathways in cancer
mcf05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101925741 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101925741 (ADCY3)
   04371 Apelin signaling pathway
    101925741 (ADCY3)
   04020 Calcium signaling pathway
    101925741 (ADCY3)
   04072 Phospholipase D signaling pathway
    101925741 (ADCY3)
   04024 cAMP signaling pathway
    101925741 (ADCY3)
   04022 cGMP-PKG signaling pathway
    101925741 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101925741 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101925741 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101925741 (ADCY3)
   04062 Chemokine signaling pathway
    101925741 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    101925741 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    101925741 (ADCY3)
   04912 GnRH signaling pathway
    101925741 (ADCY3)
   04913 Ovarian steroidogenesis
    101925741 (ADCY3)
   04915 Estrogen signaling pathway
    101925741 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    101925741 (ADCY3)
   04921 Oxytocin signaling pathway
    101925741 (ADCY3)
   04926 Relaxin signaling pathway
    101925741 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    101925741 (ADCY3)
   04918 Thyroid hormone synthesis
    101925741 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    101925741 (ADCY3)
   04916 Melanogenesis
    101925741 (ADCY3)
   04925 Aldosterone synthesis and secretion
    101925741 (ADCY3)
   04927 Cortisol synthesis and secretion
    101925741 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101925741 (ADCY3)
   04270 Vascular smooth muscle contraction
    101925741 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    101925741 (ADCY3)
   04971 Gastric acid secretion
    101925741 (ADCY3)
   04972 Pancreatic secretion
    101925741 (ADCY3)
   04976 Bile secretion
    101925741 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101925741 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101925741 (ADCY3)
   04727 GABAergic synapse
    101925741 (ADCY3)
   04725 Cholinergic synapse
    101925741 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    101925741 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    101925741 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    101925741 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    101925741 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    101925741 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101925741 (ADCY3)
   04714 Thermogenesis
    101925741 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101925741 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    101925741 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101925741 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101925741 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101925741 (ADCY3)
   05163 Human cytomegalovirus infection
    101925741 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101925741 (ADCY3)
Enzymes [BR:mcf01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101925741 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA RAP1 OPA3 Peptidase_S49_N
Other DBs
NCBI-GeneID: 101925741
NCBI-ProteinID: XP_005576474
UniProt: A0A2K5WMF6
LinkDB
Position
13
AA seq 1145 aa
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLAVAGIGLLLDII
LFVLCKKGLLPDRATRRVVPYLLWLLITAQIFSYLGLNFARAHAASDTVGWQVFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQEELKGMQLLREILANVFLYLCAIAVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLEEKGIETYLIIASKPEVKKTATQNGLNGSALPNGAPASSKSSSPALIETKEPNGSAHS
SGSTSEKPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YVTFVVGEILLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPSNATAGMETKGGCLENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVAGAVAAINLYAWRPVFDEYDHRRFREHDSLPMVTLEKMQGFTPGLNGTDRLPLVPSK
YSMTVMVFLMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFASSNKEDKSERERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKPATFPNGPSVTLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctctgagcccgagtactcggccgagtactcagccgagtac
tccgtcagcctgccttccgaccctgaccgcggggtgggccggacccatgaaatctcggtc
cggaactcgggctcctgcctgtgcctgcctcgcttcatgcggctgaccttcgtgccggag
tccttggagaacctctaccagacttacttcaaaaggcagcgccacgagaccctgctggtg
ctggtggtctttgctgccctctttgactgctacgtggtggtcatgtgtgctgtggtcttc
tccagcgacaagctggctcccctcgccgtggctggaattggactgctgttggacatcatc
ctcttcgtgctctgcaaaaaggggctgctcccggaccgggccacccgcagagtggtgccc
tacctgctgtggctgctcataactgcccagatcttctcctacctgggcctgaacttcgcg
cgtgcccacgcggccagtgacaccgtgggctggcaggtcttcttcgtcttctccttcttc
atcacgctgcctctcagcctcagccccatcgtgatcatctccgtggtctcctgtgtggtg
cacaccttggtcctgggggtcactgtggcccagcagcagcaggaggagctgaaggggatg
cagctgctgcgcgagatcctggccaacgtcttcctctacctgtgtgccatcgctgtgggc
atcatgtcctactacatggctgaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaagagcagagccagcagcaggagaacctcatgctt
tccatcctgcccaagcacgtggctgacgagatgctgaaagacatgaagaaagacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccatgagaacgtcagcatc
ctctttgccgacatcgtgggctttacccagctgtcttctgcctgcagtgcccaggagctc
gtgaagctgctcaacgagctctttgcccgctttgacaagctggcagctaaataccaccag
ctgcggattaagatcctgggcgactgctactactgcatctgcggcctgcctgactaccgg
gaggaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtat
gtgcgggagaagaccaagactggggtggacatgcgtgtgggggtgcacacgggcaccgtg
ctggggggcgtcctgggccagaagcgctggcagtacgatgtgtggtcaactgacgtcact
gtagccaacaagatggaggccggcggcatccctgggcgtgtgcacatctcccagagcacc
atggactgcctgaaaggggagtttgatgtggaaccaggcgatgggggcagccgctgtgac
tacctagaagagaagggtattgaaacctacctcatcattgcctccaagccagaggtgaag
aaaacagccacccagaatggcctcaatggctcggccctgcccaatggagcaccagcttcc
tcaaagtccagctcccctgccctcattgagaccaaggagcccaacgggagtgcccacagc
agcgggtccacatcagagaaacccgaggagcaggatgcccaggctgacaacccctcattc
cccaacccgcgccggaggctgcgcctgcaggacctggctgaccgagtggtggacgcctcc
gaagacgagcacgagctcaaccagctgctcaacgaggccctgctggagcgagagtctgcc
caagtagtaaagaagagaaacaccttcctcctgtccatgcggttcatggaccctgagatg
gaaacacgctactcggtggagaaggagaagcagagtggggctgccttcagctgctcctgc
gtcgtcctgctctgcacggctctggtcgagatactcatcgacccctggctaatgacaaac
tatgtgaccttcgtggtgggtgagattctgctcctcatcctgaccatctgctccctggct
gccatctttccccgggcctttcctaagaagcttgtggccttctcgacttggattgaccgg
acccgctgggccaggaacacctgggccatgctcgccatcttcatcctggtgatggcaaat
gtcgtggacatgctcagctgtctccagtactacacaggacccagcaacgcgacagcaggg
atggagacgaagggcggctgcctggagaaccccaagtattacaactacgtggccgtgctg
tctctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacgcttatg
ctgctcgtcgcgggcgccgtggccgccatcaacctctacgcctggcgccccgtcttcgat
gaatacgaccaccggcgttttcgggagcatgacagcttacctatggtgaccttagagaag
atgcagggattcacccctgggctcaacggcactgacaggctgcccctggtgccttccaag
tactccatgacggtgatggtgttcctcatgatgctgagcttctactacttctcccgccat
gtagaaaaactggcacggacacttttcttgtggaagattgaggtccacgaccagaaggaa
cgtgtctacgagatgcgacgctggaacgaggccttggtcaccaacatgttgcctgagcac
gtggcacgccatttcctggggtccaagaagagagatgaggagctgtacagccagacgtat
gatgagattggagtcatgtttgcctccctgcccaactttgctgacttctacacagaggag
agcatcaacaatggcggtatcgagtgtctgcgtttcctcaatgaaatcatctcggatttt
gactctctcctggacaatcccaagttccgggtgatcaccaagatcaaaaccattggcagc
acgtacatggcagcttcaggagtcacccctgacgtcaacactaatggctttgccagctcc
aacaaggaggacaagtctgagagagaacgctggcagcacctggctgacctggccgacttt
gcactggccatgaaggatacgctcaccaacatcaacaatcagtccttcaataacttcatg
ctgcgcataggcatgaacaaaggcggggttctggctggggtcatcggagcccggaaacca
cactacgacatctggggcaatacggtcaatgtagccagcaggatggagtccacgggggtc
atgggcaacatccaggtggtagaagaaacccaagtcatcctccgagagtacggcttccgc
tttgtgaggcgaggccccatctttgtgaagggaaagggggagctgctgaccttcttcttg
aaggggcgggacaagccagccaccttccccaatggcccctctgtcacactgccccaccag
gtggtagacaactcctga

DBGET integrated database retrieval system