KEGG   Macaca fascicularis (crab-eating macaque): 102115368
Entry
102115368         CDS       T02918                                 

Gene name
IKBKG
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01523  Antifolate resistance
mcf04010  MAPK signaling pathway
mcf04014  Ras signaling pathway
mcf04062  Chemokine signaling pathway
mcf04064  NF-kappa B signaling pathway
mcf04151  PI3K-Akt signaling pathway
mcf04210  Apoptosis
mcf04380  Osteoclast differentiation
mcf04620  Toll-like receptor signaling pathway
mcf04621  NOD-like receptor signaling pathway
mcf04622  RIG-I-like receptor signaling pathway
mcf04623  Cytosolic DNA-sensing pathway
mcf04625  C-type lectin receptor signaling pathway
mcf04657  IL-17 signaling pathway
mcf04658  Th1 and Th2 cell differentiation
mcf04659  Th17 cell differentiation
mcf04660  T cell receptor signaling pathway
mcf04662  B cell receptor signaling pathway
mcf04668  TNF signaling pathway
mcf04920  Adipocytokine signaling pathway
mcf05132  Salmonella infection
mcf05135  Yersinia infection
mcf05142  Chagas disease
mcf05145  Toxoplasmosis
mcf05160  Hepatitis C
mcf05161  Hepatitis B
mcf05162  Measles
mcf05163  Human cytomegalovirus infection
mcf05164  Influenza A
mcf05165  Human papillomavirus infection
mcf05166  Human T-cell leukemia virus 1 infection
mcf05167  Kaposi sarcoma-associated herpesvirus infection
mcf05168  Herpes simplex virus 1 infection
mcf05169  Epstein-Barr virus infection
mcf05170  Human immunodeficiency virus 1 infection
mcf05200  Pathways in cancer
mcf05203  Viral carcinogenesis
mcf05212  Pancreatic cancer
mcf05215  Prostate cancer
mcf05220  Chronic myeloid leukemia
mcf05221  Acute myeloid leukemia
mcf05222  Small cell lung cancer
mcf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcf05340  Primary immunodeficiency
mcf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102115368 (IKBKG)
   04014 Ras signaling pathway
    102115368 (IKBKG)
   04064 NF-kappa B signaling pathway
    102115368 (IKBKG)
   04668 TNF signaling pathway
    102115368 (IKBKG)
   04151 PI3K-Akt signaling pathway
    102115368 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102115368 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102115368 (IKBKG)
   04621 NOD-like receptor signaling pathway
    102115368 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    102115368 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    102115368 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    102115368 (IKBKG)
   04660 T cell receptor signaling pathway
    102115368 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    102115368 (IKBKG)
   04659 Th17 cell differentiation
    102115368 (IKBKG)
   04657 IL-17 signaling pathway
    102115368 (IKBKG)
   04662 B cell receptor signaling pathway
    102115368 (IKBKG)
   04062 Chemokine signaling pathway
    102115368 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102115368 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102115368 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102115368 (IKBKG)
   05203 Viral carcinogenesis
    102115368 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102115368 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102115368 (IKBKG)
   05221 Acute myeloid leukemia
    102115368 (IKBKG)
   05220 Chronic myeloid leukemia
    102115368 (IKBKG)
   05215 Prostate cancer
    102115368 (IKBKG)
   05222 Small cell lung cancer
    102115368 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    102115368 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102115368 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102115368 (IKBKG)
   05135 Yersinia infection
    102115368 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102115368 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    102115368 (IKBKG)
   05162 Measles
    102115368 (IKBKG)
   05164 Influenza A
    102115368 (IKBKG)
   05161 Hepatitis B
    102115368 (IKBKG)
   05160 Hepatitis C
    102115368 (IKBKG)
   05168 Herpes simplex virus 1 infection
    102115368 (IKBKG)
   05163 Human cytomegalovirus infection
    102115368 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102115368 (IKBKG)
   05169 Epstein-Barr virus infection
    102115368 (IKBKG)
   05165 Human papillomavirus infection
    102115368 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102115368 (IKBKG)
   05142 Chagas disease
    102115368 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102115368 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcf01001]
    102115368 (IKBKG)
Protein kinases [BR:mcf01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102115368 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 LLC1 Bacillus_HBL
Other DBs
NCBI-GeneID: 102115368
NCBI-ProteinID: XP_005595059
UniProt: A0A2K5V0U3
LinkDB
Position
X
AA seq 487 aa
MALVIQVRKLRPREVNTLQTLSPSLFPSLPVRLSGLIEVPSGGERCCSRCTLVYKARAFW
KGAPLPCWMSRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQ
RCLEENQELRDAIRQSNQMLRERCEELLHFQASQREEKEFLMCKFQEARKLVERLSLEKL
DLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQTLEG
RARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQV
AYHQLFQEYDNHIKSSLVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHK
IVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESAR
IEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQI
HVMECIE
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggcccttgtgatccaggtgaggaaactaaggcccagagaggtgaataccctgcagact
ctcagtcccagtctcttcccctcactccctgtgaggctctccggcctcatcgaggtccca
tcaggtggggaaagatgctgttccaggtgcacactggtctacaaggccagagctttctgg
aagggggcacccctgccctgttggatgagcaggcacctctggaagagccaactgtgtgag
atggtgcagcccagtggtggcccggcagcagatcaggacgtgctgggtgaagagtctcct
ctggggaagccagccatgctgcacctgccttcagagcagggcgctcctgagactctccag
cgctgcctggaggagaatcaagagctccgagatgccatccggcagagcaaccagatgctg
cgagagcgctgcgaggagcttctgcatttccaagccagccagagggaggagaaggagttc
ctcatgtgcaaattccaagaggccaggaaactggtggagagactcagcctggagaagctc
gacctgaagaggcagaaagagcaggctctgcgggaggtagagcacctgaagagatgccag
cagcagatggctgaggacaaggcctctgtgaaagcccaggtgacatccttgctcggggag
ctgcaggagagccagagtcgcctggaggctgccactaaggaatgccagactctggagggt
cgggcccgggcggccagcgagcaggcgcggcagctggagagtgagcgtgaggcactgcag
cagcagcacagcgtgcaggtggaccagctgcgcatgcagggccagagcgtggaggccgca
ctccgcatggagcgccaggctgcctcggaggagaagcggaagctggcccagttgcaggtg
gcctatcaccagctcttccaagaatacgacaaccacatcaagagcagcctggtgggcagc
gagcggaagcgaggaatgcagctggaagatctcaagcagcagctccagcaggccgaggag
gccctggtggccaaacaggaggtgattgataagctgaaggaggaggccgagcagcacaag
attgtgatggagaccgttccggtgctgaaggcccaggcggacatctacaaggcggacttc
caggctgagaggcaggctcgggagaagctggccgagaagaaggagctcttgcaggagcag
ctggagcagctgcagagggagtacagcaaactgaaggccagctgtcaggagtcggccagg
atcgaggacatgaggaagcggcatgttgaggtctcccaggcccccttgccccccgccccc
gcctacctctcctctcccctggccctgcccagccagaggaggagcccccctgaggagcca
cctgacttctgctgtcccaagtgccagtatcaggcccctgatatggacaccctgcagata
catgtcatggagtgcattgagtag

DBGET integrated database retrieval system