KEGG   Macaca fascicularis (crab-eating macaque): 102116240Help
Entry
102116240         CDS       T02918                                 

Gene name
ACADS
Definition
(RefSeq) acyl-CoA dehydrogenase, C-2 to C-3 short chain
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00071  Fatty acid degradation
mcf00280  Valine, leucine and isoleucine degradation
mcf00410  beta-Alanine metabolism
mcf00640  Propanoate metabolism
mcf00650  Butanoate metabolism
mcf01100  Metabolic pathways
mcf01200  Carbon metabolism
mcf01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    102116240 (ACADS)
   00650 Butanoate metabolism
    102116240 (ACADS)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102116240 (ACADS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102116240 (ACADS)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102116240 (ACADS)
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     102116240 (ACADS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 HpaB_N
Motif
Other DBs
NCBI-GeneID: 102116240
NCBI-ProteinID: XP_005572473
LinkDB All DBs
Position
11
AA seq 412 aa AA seqDB search
MAAALLARASGPVRRALCPRAWRQLHTIYQSVELPETHQMLLQTCRDFAEKELFPIAAQV
DKEQLFPAAQVKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNN
SLYLGPILKFGSKEQKQKWVTPFTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLN
GTKAWITNAWEASAAVVFASTDRALQNKGISAFLVPMPTPGLTLGKKEDKLGIRGSSTAN
LIFEDCRIPKDSILGEPGMGFKIAMQTLDMGRIGIASQALGIAQTALDCAANYAENRMAF
GAPLTKLQVIQFKLADMALALESARLLTWRAAMLKDNKKPFIKEAAMAKLAASEAATAIS
HQAIQILGGMGYVTEMPAERHYRDARITEIYEGTSEIQRLVIAGHLLRSYRS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcgctgctcgcccgggcctctggccctgtccgcagagctctctgtcctagg
gcctggcggcagttacacaccatctaccagtctgtggaactgcctgagacacaccagatg
ttgctccagacatgccgggactttgcagagaaggagttgtttcccattgcagcccaggtg
gataaggaacagctcttcccagccgctcaggtgaagaagatgggcgggctcgggcttctg
gccatggacgtgcccgaggagcttggcggtgccggccttgattacctggcctacgccatc
gccatggaggagatcagccgcggctgcgcctccactggagtcatcatgagtgtcaacaat
tctctctacctggggcccatcttgaagtttggctccaaggagcagaagcagaagtgggtc
acgcctttcaccagtggtgataaaattggctgctttgccctcagcgaaccaggaaacggt
agcgatgcaggagccgcgtccaccaccgcccgggccgagggcgactcgtgggtcctgaat
ggcaccaaagcctggatcaccaatgcctgggaggcctcggctgccgtggtctttgccagc
acagacagagccctgcaaaacaagggcatcagtgccttcctggtccccatgccaacgcct
gggctcacgttggggaagaaggaagacaagctgggcatccggggctcatccacggccaac
ctcatctttgaggactgtcgcatccccaaggacagcatcctgggggagccggggatgggc
ttcaagatagccatgcaaaccctggacatgggccgcatcggcatcgcctcccaggccctg
ggcattgcccagaccgccctcgattgtgctgcgaactatgctgagaatcgcatggccttc
ggggcgcccctcaccaagctccaggtcatccagttcaagttggcagacatggccttggcc
ctggagagtgcccggctgctgacctggcgcgctgccatgctgaaggataacaagaagcct
ttcatcaaggaggcagccatggccaagctggccgcctcggaggctgcgaccgccatcagc
caccaggccatccagatcctgggcggcatgggctatgtgacagagatgccagcagaacgg
cactaccgcgatgcccgtatcactgagatctacgagggcaccagcgaaatccagcggctg
gtgatcgccgggcacctgctcaggagctaccggagctga

DBGET integrated database retrieval system