KEGG   Macaca fascicularis (crab-eating macaque): 102117136Help
Entry
102117136         CDS       T02918                                 

Gene name
GALNT9, GalNAc-T9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00512  Mucin type O-glycan biosynthesis
mcf01100  Metabolic pathways
Module
mcf_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    102117136 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mcf01003]
    102117136 (GALNT9)
Enzymes [BR:mcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     102117136 (GALNT9)
Glycosyltransferases [BR:mcf01003]
 O-Glycan biosynthesis
  Mucin-type
   102117136 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 102117136
NCBI-ProteinID: NP_001306356
UniProt: Q9GM01
LinkDB All DBs
Position
11
AA seq 606 aa AA seqDB search
MAVARKIRTLLTVNILVFVGIVLFSVYCRLQGRSQELVRPLSGGCRPRPATPAPGSPLRS
GGPRAVVAGRAELVLKGQLPAEPCSPGRLMVPEAEAEAQGGLAATLRDDGQEAEGKYEEY
GYNAQLSDRISLDRSIPDYRPRKCRHMSYAQDLPQVSVVFIFVNEALSVILRSVHSVVNH
TPSQLLKEVILVDDNSDNVELKFNLDQYVNKRYPGLVKIVRNSRREGLIRARLQGWKAAT
APVVGFFDAHVEFNTGWAEPALSRIREDRRRIVLPAIDNIKYSTFEVQQYANAAHGYNWG
LWCMYIIPPQDWLDRGDESAPIRTPAMIGCSFVVDREYFGDIGLLDPGMEVYGGENVELG
MRVWQCGGSMEVLPCSRVAHIERTRKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWN
IPMTNPGVDFGDVSERLALRQRLKCRSFKWYLENVYPEMRIYNNTLTYGEVRNSKASGYC
LDQGAEDGDRAILYPCHGMSSQLVRYSADGLLQLGPLGSTAFLPDSKCLVDDGRGRTPTL
RKCEDVARPTQRLWDFTQSGPIVSRATGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNW
IKHARH
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggccaggaagatccgaactttgctgacggtgaacatcctggtgttcgtgggc
atcgtcctgttctccgtgtactgccgcctgcagggccgctcccaggagctcgtgcgccct
ctgagtgggggatgccggccgcgccccgcgaccccagccccgggcagccccctgcgctct
gggggaccccgggcggtagtggccgggcgcgctgagctggtgctgaagggacagctcccg
gccgagccctgcagccccgggcggctcatggtccccgaagccgaagccgaagcccagggc
ggtttggcggccaccctgcgtgatgacggccaggaggcggaaggcaagtatgaggagtac
ggctacaacgctcagctcagtgaccgcatctccctggatcggagcatccccgactaccgg
cccagaaagtgcagacacatgagctacgcccaggacctgccccaggtctccgtggtcttc
atcttcgtcaacgaggcgctgtcggtcatcctgcgctccgtgcacagcgtggtcaaccac
acgccctcccagctcctcaaggaggtcatcctggtggacgataacagtgacaatgtggag
ctcaagttcaatctggaccagtatgtcaacaagcggtacccgggcctcgtgaagatcgtc
cgcaatagccggcgggaaggactgatccgcgcccggctgcagggctggaaggcggccact
gccccagtcgtcggcttcttcgatgcccacgtcgagttcaacacaggctgggcggagccc
gcactgtctcggatccgagaggaccggcgtcgcatcgtgctgccagccatagacaacatc
aagtacagcacgtttgaggtgcagcagtacgccaacgctgcccacggctacaactggggc
ctctggtgcatgtacatcatccccccgcaggactggctggaccgcggcgacgagtcagca
cccatcaggactccggccatgatcggctgctccttcgtggtggaccgcgagtacttcgga
gacattgggctgctagaccctggcatggaggtgtacggtggcgagaacgtagaactgggc
atgagggtgtggcagtgtggtggcagcatggaggtgctgccctgctcccgcgtggcccac
atcgagcgcaccaggaagccctacaacaacgacatcgactactatgccaagcgcaacgcc
ctgcgcgccgccgaggtgtggatggacgacttcaagtcccacgtgtacatggcctggaac
atccccatgacgaacccaggggtggacttcggggacgtgtctgagaggctggccctgcgc
cagaggctgaagtgccgcagcttcaagtggtacctggagaacgtgtacccggagatgagg
atctacaacaacaccctcacgtacggagaggtgagaaacagcaaagccagcggctactgc
ctggaccagggagcagaggacggcgaccgggcgatcctctacccctgccacgggatgtcc
tcccagctggtgcggtacagcgctgacggcctgctgcagctggggcctctgggctccaca
gccttcttgcccgactccaagtgtctggtggatgacggcaggggccgcacgcccaccctg
aggaagtgtgaggatgtggcaaggcccacacagcggctgtgggacttcacccagagcggc
cccattgtgagccgggccacgggccgctgcctggaggtggagatgtccaaagacgccaac
ttcgggctccggctggtggtgcagaggtgctcggggcagaagtggatgatcagaaactgg
atcaaacatgcacggcactga

DBGET integrated database retrieval system