KEGG   Macaca fascicularis (crab-eating macaque): 102117174Help
Entry
102117174         CDS       T02918                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00052  Galactose metabolism
mcf00500  Starch and sucrose metabolism
mcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102117174 (GANC)
   00500 Starch and sucrose metabolism
    102117174 (GANC)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102117174 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102117174
NCBI-ProteinID: XP_005559352
UniProt: A0A2K5W0E6
LinkDB All DBs
Position
7
AA seq 914 aa AA seqDB search
MEAAEKEEISVEDEAVDKNIFRDCNKIAFYRRQKQWLSKKSAYQALLDSVTTDEDSTRFQ
IINEASKVTLLAEIYGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTVRLISCSGDTGN
LILADGKGGLKCHITANPFKVDLVSEEEVVISINSLGQLYFEHLQILHKQRAAKENEEEA
SVDTSQENQEDLGLWEEKFGKFVDIKANGPSSIGLDFSLHGFEHLYGIPQHAESHQLKNT
GDEDAYRLYNLDVYGYQIYDKMGIYGSVPYLLAHKLGRTIGIFWLNASETLVEINTEPAV
EYTLSQMGPVAAKQKVRSRTHVHWMSESGIIDVFLLTGPTPSDVFKQYSHLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDAMWLDIEHTEGKRYFTWDKKRFPNPER
MQELLRSKKRKLVVISDPHIKIDPDYSVYVKAKDQGFFVKNQEGEDFEGVCWPGLSSYLD
FTNPKVREWYSSLFAFPVYQGSTDILFLWNDMNEPSVFRGPEQTMQKNAIHHGNWEHREL
HNIYGFYHQMATAEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKISIP
MLLTLSITGISFCGADIGGFIGNPETELLVRWYQAGAYQPFFRGHATMNAKRREPWLFGK
EHTRLIREAIRERYGLLPYWYSLFYHAHVASQPVMRPLWVEFPDELKTFDMEDEYMLGSA
LLVHPVTEPKATTVDVFLPGSNEVWYDYKTFAHWEGGCTVKIPVALDTIPVFQRGGSVVP
IKTTVGKSTGWMTESSYGLRVALSTKGSSVGELYLDDGHSFQYLHQKQFLHRKFSFCSSV
LINSSADQRGHYPSKCVVEQILVLGLRKEPSFVTTHSSDGKDQPVAFTYCAKTSSLSLEK
LSLNIATDWEVRII
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagctgagaaagaggaaataagcgttgaagatgaagctgtggataaaaacatt
ttcagagactgcaacaagatcgcattttacaggcgtcagaaacagtggctttccaagaag
tccgcctatcaggcattactggactcagtcacaacagatgaagacagcaccaggttccaa
atcatcaatgaagcaagtaaggttactctcctggctgaaatttatggtatagaaggaaac
attttcaggcttaaaattaatgaagagactcctctaaaacccaggtttgaagttcctgat
gtcctcacaagcaagccaagcactgtaaggctgatttcatgctcaggggacacagggaat
ctgatattggcagatggaaaaggaggcctgaagtgccatatcacagcaaacccattcaag
gtagacttggtgtctgaagaagaggttgtgattagcataaattccctgggccaattatac
tttgagcatttacagattcttcacaaacaaagagctgctaaagaaaatgaggaggaggca
tcagtggacacctctcaggaaaatcaagaggatctgggcctgtgggaagagaaatttgga
aaatttgtggatatcaaagctaatggtccttcttccattggtttggatttctccttgcat
ggatttgagcatctctatgggatcccacaacatgcagaatcacaccaacttaaaaatact
ggtgatgaagatgcttaccgtctttataacctggatgtctatggataccaaatatatgat
aaaatgggcatttatggttcagtaccttatctcctggcccacaaactgggcagaactata
ggcattttctggctgaatgcctcagaaacactagtggagatcaatacagagcctgcagta
gagtatacactgtcccagatgggcccagttgctgctaaacaaaaggtcagatctcgaact
catgtgcactggatgtcagaaagtggaatcattgatgtttttctgctgacaggacctaca
ccttctgatgtcttcaaacagtactcacaccttacaggcacacaagccatgccccctctt
ttctctttgggataccaccagtgccgctggaactatgaagatgagcaggacgtaaaagca
gtggatgcagggtttgatgagcatgacattccttatgatgccatgtggctggacatagag
cacactgagggcaagaggtacttcacctgggacaaaaaaagattcccaaaccccgagagg
atgcaagagctgcttaggagcaaaaagcgtaagcttgtggtcatcagtgatccccacatc
aagattgatcctgactactcagtatatgtgaaggccaaagatcagggcttctttgtgaag
aatcaggaaggggaagactttgaaggagtgtgctggccaggtctctcctcttacctggat
ttcaccaatcccaaggtcagagagtggtattcaagtctttttgctttccctgtttatcag
ggatctacggacatcctcttcctttggaatgacatgaatgagccctctgtctttagaggg
ccagagcaaaccatgcagaagaatgccattcatcatggcaattgggagcacagagaactc
cacaacatctacggtttttatcatcaaatggccactgcagaaggactgatacagcgatct
aaagggaaggagagaccctttgttcttacacgttctttctttgctggatcacaaaagtat
ggtgctgtgtggacaggcgacaacacagcagaatggagctacctgaaaatttctatccca
atgttactcactctcagcattactgggatctctttttgtggagctgacataggcgggttc
attgggaatccagagacagagctgctagtgcgttggtaccaggccggagcctaccagccc
ttcttccgtggccatgccaccatgaatgccaagcgacgggagccctggctctttgggaag
gaacacacccggctcatccgagaagccatcagagagcgctatggcctcttgccatattgg
tattctctgttctaccatgcacacgtggcttcccaacctgtcatgaggcctctgtgggtg
gagttcccagatgaactaaagacttttgatatggaagatgaatacatgctggggagtgca
ttattggttcatccagtcacagaaccaaaagccaccacagttgatgtgtttcttccggga
tcaaatgaggtctggtatgactataagacatttgctcattgggaaggagggtgtactgta
aagatcccagtagccttggacactattccagtgtttcagcgaggtggaagtgtggtacca
ataaagacaactgtaggaaaatccacaggctggatgactgaatcctcctatggactccgg
gttgctctaagcactaagggttcttcagtgggtgagttgtatcttgatgatggccattca
ttccaatacctccaccagaagcaatttttgcacaggaagttttcattctgttccagcgtt
ttgatcaatagttctgccgaccagagaggtcattatcccagcaagtgtgtggtggagcag
atcttggtcttaggcctcaggaaggagccatcttttgtgactacccactcatctgatggt
aaagatcagcctgtggcttttacgtattgtgccaaaacgtccagcctgagcctggagaag
ctctcgctcaacattgccactgactgggaggtccgcatcatatga

DBGET integrated database retrieval system