KEGG   Macaca fascicularis (crab-eating macaque): 102117319Help
Entry
102117319         CDS       T02918                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00480  Glutathione metabolism
mcf00980  Metabolism of xenobiotics by cytochrome P450
mcf00982  Drug metabolism - cytochrome P450
mcf00983  Drug metabolism - other enzymes
mcf01524  Platinum drug resistance
mcf05200  Pathways in cancer
mcf05204  Chemical carcinogenesis
mcf05225  Hepatocellular carcinoma
mcf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102117319 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102117319 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    102117319 (GSTO1)
   00983 Drug metabolism - other enzymes
    102117319 (GSTO1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    102117319 (GSTO1)
   05204 Chemical carcinogenesis
    102117319 (GSTO1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    102117319 (GSTO1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    102117319 (GSTO1)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    102117319 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcf02000]
    102117319 (GSTO1)
Enzymes [BR:mcf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102117319 (GSTO1)
Transporters [BR:mcf02000]
 Other Transporters
  Pores ion channels [TC:1]
   102117319 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 102117319
NCBI-ProteinID: NP_001274622
UniProt: C0SJM5
LinkDB All DBs
Position
9
AA seq 241 aa AA seqDB search
MSRESARSLGKGSAPPGPVPEGSIRVYSMRFCPFAERTLLVLKAKGIRHEVININLKNKP
EWFFKKNPFGLVPVLENSQGQLIYESPITCEYLDEAYPGKKLLPDDPYEKACQKMILELF
SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPW
FERLEAMKLYECVDHTPKLKLWMAAMKEDPTVSALLISGKDWQGFLELYLQNSPEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgggagtctgccaggagcctggggaagggaagcgcgcccccggggccggtcccg
gagggctcgatccgcgtctacagcatgaggttctgcccgtttgctgagaggacgcttctg
gtcctgaaggccaagggaatcaggcatgaagtcatcaatatcaacctgaaaaataagcct
gagtggttctttaagaaaaatccctttggtctggtgccagttctggaaaacagtcagggt
cagctgatctatgagtctcccatcacctgtgagtacctggatgaagcatacccagggaag
aagctgttgccggatgacccctatgagaaagcttgccagaagatgatcttagagttgttt
tctaaggtgccatccttggtaggaagctttattagaagccaaaataaagaagactatgct
ggcctaaaagaagaatttcgtaaagaatttaccaagctagaggaggttctgactaataag
aagacgacgttctttggtggcaattctatctctatgattgattatctcatctggccctgg
tttgaacggctggaagcaatgaagttatatgagtgtgtagaccacactccaaaacttaaa
ctgtggatggcagccatgaaggaagatcccacagtctcagccctgctcattagtgggaag
gactggcaaggtttcctagagctttacttacagaacagccctgaggcctgtgactatggg
ctctga

DBGET integrated database retrieval system