KEGG   Macaca fascicularis (crab-eating macaque): 102117388Help
Entry
102117388         CDS       T02918                                 

Gene name
KMT5B, SUV420H1
Definition
(RefSeq) lysine methyltransferase 5B
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102117388 (KMT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcf03036]
    102117388 (KMT5B)
Enzymes [BR:mcf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102117388 (KMT5B)
Chromosome and associated proteins [BR:mcf03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102117388 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 102117388
NCBI-ProteinID: XP_005577081
LinkDB All DBs
Position
14
AA seq 713 aa AA seqDB search
MQEKLFKEHVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIA
ELSEIEENMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVK
ALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLR
ETDKRLNRLKKLGDSSKNSDSQSVSSNTDADTTQEKNNATSNRKSSVGVKKNSKSRTLTR
QSMSRIPASSNSTSSKLTHINNSRVPKKLKKPAKPLLSKIKLRNHCKRLEQKNASRKLEM
GNLVLKEPKVVLYKNLPIKKDKEPEGPAQAAVASGCLTRHAAREHRQNPVRGAHSQGESS
PCTYITRRSVRTRTNLKAASDIKLEPNTLDGYKSSVTEPCPDSGEQPQPAPVVQEEELAH
ETAQKGEAKCHKSDTGVSKKKSRQGKLVKQFAKIEESTPVRDSPGKDDAVPDLMGPHSDQ
GEHSGTVGMPVNYTDCAPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENN
SGIPKLTLRRRHDSSSKTNDQENDGMNSSKISIKLSKDHDNDNNLYVAKLNNGFNSGSGS
SSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESRMEVDDYSQYEEESTDDSSSS
EGDEEEDDYDDDFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagaagttattcaaagaacatgtatttatttatttgcgaatgtttgcaactgac
agtggatttgaaatattgccatgtaatagatactcatcagaacaaaatggagccaaaata
gttgcaacaaaagagtggaaacgaaatgacaaaatagaattactggtgggttgtattgcc
gaactttcagaaattgaggagaacatgctacttagacatggagaaaacgacttcagtgtc
atgtattccacaaggaaaaactgtgctcaactctggctgggtcctgctgcatttataaac
catgattgcagacctaattgtaagtttgtgtcaactggtcgagatacagcatgtgtgaag
gctctgagagatattgaacctggagaagaaatttcttgttattatggagatgggttcttt
ggagaaaataatgagttctgcgagtgttacacttgcgaaagacggggaactggtgctttt
aaatccagagtgggactgcctgcgcctgctcctgttatcaatagcaaatatggactcaga
gaaacagataaacgtttaaataggcttaaaaagttaggtgacagcagcaaaaattcagac
agtcaatctgtcagctctaacactgatgcagataccactcaggaaaaaaacaatgcaact
tctaaccgaaaatcttcagttggtgtaaaaaagaatagcaagagcagaacgttaacgagg
caatctatgtcaagaattccagcttcttccaactctacctcatctaagctaactcatata
aataattccagggtaccaaagaaactgaagaagcctgcaaagcctttactttcaaagata
aaattgagaaatcattgcaagcggctggagcaaaagaatgcttcaagaaaactcgaaatg
ggaaacttagtactgaaagagcctaaagtagttctatataaaaatttgcccattaaaaaa
gataaggagccagagggaccagcccaagccgcagttgccagcgggtgcttgactagacat
gcggcgagagaacacagacagaatcctgtgagaggtgctcattcgcagggggagagctcg
ccctgcacctacataacccggcggtcagtgaggacaagaacaaatctgaaggcggcctct
gacatcaagcttgaaccaaatacgttggatggctataaaagcagtgtgacggaaccttgc
cctgacagtggggaacagccacagccagctcccgtggtgcaggaggaagaactggctcat
gagactgcgcaaaagggggaggctaagtgtcataagagtgacacaggcgtgtccaaaaag
aagtcacgacaaggaaaacttgtgaaacagtttgcgaaaatagaggaatctactccagtg
cgtgattctcctggaaaagacgatgcggtaccagatttgatggggccccattctgaccag
ggcgagcacagtggcactgtgggcatgcctgtgaactacacagactgtgctccttcaccc
gtcggttgttcagttgtgacatcagatagcttcaaaacaaaagacagctttagaactgca
aaaagtaaaaagaagaggcgaatcacaaggtatgacgcacagttaatcctagaaaataac
tctgggattcccaaattgactcttcgtaggcgtcatgatagcagcagcaagacaaatgac
caagagaatgatggaatgaattcttcaaaaataagcatcaagttaagcaaagaccatgac
aacgataacaatctctatgtagcaaagcttaataatggatttaactcaggatcaggcagt
agttctacaaaattaaaaatccaactaaaacgagatgaggaaaatagggggtcttataca
gaagggcttcatgaaaatggggtgtgctgcagtgatcctctttctctcttggagtctcga
atggaggtggatgactatagtcaatatgaggaagaaagtacagatgattcctcctcttct
gagggcgacgaagaggaggatgactatgatgatgactttgaagacgattttattcctctt
cctccagctaagcgattgaggttaatagttggaaaagactctatagatattgacatttct
tcaaggagaagagaagatcagtctttaaggcttaatgcctaa

DBGET integrated database retrieval system