KEGG   Macaca fascicularis (crab-eating macaque): 102117954
Entry
102117954         CDS       T02918                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf01522  Endocrine resistance
mcf04012  ErbB signaling pathway
mcf04066  HIF-1 signaling pathway
mcf04068  FoxO signaling pathway
mcf04110  Cell cycle
mcf04151  PI3K-Akt signaling pathway
mcf04933  AGE-RAGE signaling pathway in diabetic complications
mcf04934  Cushing syndrome
mcf05162  Measles
mcf05165  Human papillomavirus infection
mcf05169  Epstein-Barr virus infection
mcf05200  Pathways in cancer
mcf05202  Transcriptional misregulation in cancer
mcf05203  Viral carcinogenesis
mcf05206  MicroRNAs in cancer
mcf05215  Prostate cancer
mcf05220  Chronic myeloid leukemia
mcf05222  Small cell lung cancer
mcf05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102117954 (CDKN1B)
   04066 HIF-1 signaling pathway
    102117954 (CDKN1B)
   04068 FoxO signaling pathway
    102117954 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    102117954 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102117954 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102117954 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    102117954 (CDKN1B)
   05206 MicroRNAs in cancer
    102117954 (CDKN1B)
   05203 Viral carcinogenesis
    102117954 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    102117954 (CDKN1B)
   05220 Chronic myeloid leukemia
    102117954 (CDKN1B)
   05215 Prostate cancer
    102117954 (CDKN1B)
   05222 Small cell lung cancer
    102117954 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102117954 (CDKN1B)
   04934 Cushing syndrome
    102117954 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    102117954 (CDKN1B)
   05169 Epstein-Barr virus infection
    102117954 (CDKN1B)
   05165 Human papillomavirus infection
    102117954 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102117954 (CDKN1B)
SSDB
Motif
Pfam: CDI Multi-haem_cyto
Other DBs
NCBI-GeneID: 102117954
NCBI-ProteinID: XP_005570240
LinkDB
Position
11
AA seq 206 aa
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHRPLEGKYEWQEVEKGSLPEFYYRPPRAPKGACKVPAQESQDVSGSRPAAPLIG
APANPEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDGNDPFPTDDSSTQNKRANRTEE
NVSDGSPNAGSVEQTPKKPGLRRRQT
NT seq 621 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagccctagcctagagcggatggacgccaggcag
gcggagcaccccaagccctcggcctgcaggaacctcttcggcccggtggaccacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggcgagccagcgcaagtgg
aatttcgattttcagaatcacagacccctagagggcaagtacgagtggcaagaggtggag
aagggcagcttgcctgagttctactatagacccccgcgggcccccaaaggcgcctgcaag
gtgccggcgcaggagagccaggatgtcagcgggagccgcccggcggcgcctttaattggg
gctccggctaaccctgaggacacgcatttggtagacccaaagactgatccgtcggacagc
cagaccgggttagcggagcagtgcgcaggaataaggaagcgacctgcaaccgacggtaat
gaccccttcccaaccgacgattcttccactcaaaacaaaagagccaacagaacagaagaa
aatgtttcagacggttccccaaatgccggttctgtggagcagacgcccaagaagcctggc
ctcagaagacgtcaaacgtaa

DBGET integrated database retrieval system