KEGG   Macaca fascicularis (crab-eating macaque): 102118362
Entry
102118362         CDS       T02918                                 

Gene name
IL3
Definition
(RefSeq) interleukin 3
  KO
K04736  interleukin 3
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04060  Cytokine-cytokine receptor interaction
mcf04151  PI3K-Akt signaling pathway
mcf04210  Apoptosis
mcf04630  JAK-STAT signaling pathway
mcf04640  Hematopoietic cell lineage
mcf04664  Fc epsilon RI signaling pathway
mcf05200  Pathways in cancer
mcf05202  Transcriptional misregulation in cancer
mcf05221  Acute myeloid leukemia
mcf05310  Asthma
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102118362 (IL3)
   04151 PI3K-Akt signaling pathway
    102118362 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102118362 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102118362 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102118362 (IL3)
   04664 Fc epsilon RI signaling pathway
    102118362 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102118362 (IL3)
   05202 Transcriptional misregulation in cancer
    102118362 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102118362 (IL3)
  09163 Immune disease
   05310 Asthma
    102118362 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcf04052]
    102118362 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:mcf00536]
    102118362 (IL3)
Cytokines and growth factors [BR:mcf04052]
 Cytokines
  Interleukins
   102118362 (IL3)
Glycosaminoglycan binding proteins [BR:mcf00536]
 Heparan sulfate / Haparin
  Cytokines
   102118362 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 102118362
NCBI-ProteinID: XP_005557770
LinkDB
Position
6
AA seq 143 aa
MSRLPVLLLLHLLVSPGLQAPMTQTTSLKTSWAKCSNMIDEIITHLNQPPLPSPDFNNLN
EEDQTILVEKNLRRSNLEAFSKAVKSLQNASAIESILKNLPPCLPMATAAPTRPPIRITN
GDRNDFRRKLKFYLKTLENEQAQ
NT seq 432 nt   +upstreamnt  +downstreamnt
atgagccgcctgcccgtcctgctcctgctccatctcctggtcagccccggactccaagct
cccatgacccagacaacgtccttgaagacaagctgggctaagtgctctaacatgatcgat
gaaattataacacacttaaaccagccacctttgccttcaccggacttcaacaacctcaat
gaggaagaccaaaccattctggtggaaaaaaaccttcgaaggtcaaacctggaggcattc
agtaaggctgtcaagagtttacagaacgcatcagcaatcgagagcattcttaagaatctc
ccaccatgcctgcccatggccacggccgcacccacgcgacctccaatccgtatcacgaac
ggtgaccggaatgacttccggaggaaactgaagttctatctgaaaacccttgagaatgag
caggctcaatag

DBGET integrated database retrieval system