KEGG   Macaca fascicularis (crab-eating macaque): 102118687Help
Entry
102118687         CDS       T02918                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04146  Peroxisome
mcf04213  Longevity regulating pathway - multiple species
mcf05014  Amyotrophic lateral sclerosis (ALS)
mcf05016  Huntington disease
mcf05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102118687 (SOD1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    102118687 (SOD1)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    102118687 (SOD1)
   05016 Huntington disease
    102118687 (SOD1)
   05020 Prion diseases
    102118687 (SOD1)
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102118687 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 102118687
NCBI-ProteinID: NP_001272335
UniProt: Q8HXQ1
LinkDB All DBs
Position
3
AA seq 154 aa AA seqDB search
MAMKAVCVLKGDSPVQGTINFEQKESNGPVKVWGSITGLTEGLHGFHVHQFGDNTQGCTS
AGPHFNPLSRQHGGPKDEERHVGDLGNVTAGKDGVAKVSFEDSVISLSGDHSIIGRTLVV
HEKADDLGKGGNEESKKTGNAGGRLACGVIGIAQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaaggccgtgtgcgtgttgaagggcgacagcccagtgcagggcaccatcaat
ttcgagcagaaggaaagtaatggaccagtgaaggtgtggggaagcattacaggattgact
gaaggcctgcatggattccatgttcatcagtttggagataatacacaaggctgtaccagt
gcaggtcctcactttaatcctctatccagacaacacggtgggccaaaggatgaagagagg
catgttggagacctgggcaatgtgactgctggcaaagatggtgtggccaaggtgtctttc
gaagattctgtgatctcgctctcaggagaccattccatcattggccgcacattggtggtc
catgaaaaagcagatgacttgggcaaaggtggaaatgaagaaagtaaaaagacaggaaac
gctggaggtcgtctggcttgtggtgtaattgggatcgcccaataa

DBGET integrated database retrieval system