KEGG   Macaca fascicularis (crab-eating macaque): 102118894Help
Entry
102118894         CDS       T02918                                 

Gene name
TGM1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102118894 (TGM1)
Enzymes [BR:mcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102118894 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 102118894
NCBI-ProteinID: XP_015309139
UniProt: A0A2K5UQU1
LinkDB All DBs
Position
7
AA seq 842 aa AA seqDB search
MEGFWVSWLGLPGLRSHPRLFLTGMMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDRRFR
RGGGGRSFWARCCGCCSCRNVADDDWGPEPSDSRGRGSSSGTRRPGSRGSDSRQPVSRGS
GVNAAGDGTIREGMLVVTGVDLLSSRSDQNRQEHHTDEYEYDELIVRRGQPFRMLLLLSR
TYESSDRITLELLIGNNPEVGKGTHVIIPVGKGGSGGWKAQVTKASGQTLNLRVHTSPNA
IIGKFQFTVRTQSDAGEFQLPFDPRNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRI
YYGTEAQIGERTWNYGQFDHGVLDACLYILDRRGMPYGGRGDPVSVSRVISAMVNSLDDN
GVLIGNWSGDYSRGTNPSAWVGSVEILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLAT
RTVTNFNSAHDTDTSLTMDIYFDENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGW
QVVDATPQETSSGIFCCGPCSVESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKI
VYVEEKAIGTLIVTKAIGSNMREDITYLYKHPEGSDAERKAVETAAAHGSKPNVYANRGS
AEDVAMQVEAQDAVMGQDLMVSIMLTNHSSSRRTVKLHLYLSVTFYTGVTGTIFKETKKE
VELAPGASDRVTMPVAYKEYRPHLVDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSL
TLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQT
FVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPAPGDRGFFSDAGGDSHLGETIPMASRG
GA
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggagggtttctgggtcagctggctggggctacctgggttaaggagccacccccgcctc
ttcctaacaggcatgatggacgggccacgttccgacgttggccgttggggtggcaacccc
ttgcagccccctaccacgccttctccagagccagagccagagccagacagacgctttcgc
agaggaggaggaggccgttccttctgggctcgctgctgtggctgctgttcatgccgaaat
gtggcagatgatgactggggacctgaaccctctgactccaggggtcgagggtccagctct
gggactcgaagacctggctcccggggctcagactcccgccagcctgtctcccggggcagc
ggtgtcaatgcagctggagatggcaccatccgagagggcatgctagtagtgaccggtgtg
gacttgctgagctcgcgctcggaccagaaccgccaagagcaccacacagacgagtatgaa
tacgatgagctgatagtacgtcgcgggcagcctttccgcatgcttctcctcctgtcccgg
acctatgaatcctctgatcgcatcacccttgagttactcattggaaacaaccccgaggtg
ggcaagggcacgcacgtgatcatcccagtgggcaaggggggcagtggaggctggaaagcc
caggtgaccaaggccagtgggcagactctgaacctacgggtccacacttcccccaacgcc
atcatcggcaagtttcagttcacagtccgcacacagtcagacgctggggagttccagttg
ccctttgacccccgcaacgagatctacatcctcttcaacccctggtgcccagaggacatt
gtgtacgtggaccatgaggattggcggcaggagtatgtgcttaatgagtctgggagaatt
tactacgggaccgaagcacagattggcgagcggacctggaactatggccagtttgaccac
ggggtgctggatgcctgcctatacatcctggaccggcgggggatgccatatggaggccgt
ggagacccagtcagtgtctcccgggtcatctctgccatggtgaactccctggatgacaat
ggagtcctgattgggaactggtctggtgattactcccgaggcaccaacccatcagcgtgg
gtgggcagcgtggagatcctgcttagctacctacgcaccggctattccgtcccatatggc
cagtgctgggtctttgctggcgtgaccactacagtgctgcgctgcctgggtctggccacc
cgtactgtcaccaacttcaactccgcccatgacacagacacatctcttaccatggacatc
tacttcgatgagaacatgaagcccctagagcacctgaaccatgattctgtctggaacttc
cacgtgtggaacgactgctggatgaagaggccagatcttccctcgggctttgatgggtgg
caggtggtggatgccacaccccaggagactagcagtggcatcttctgctgtggcccctgc
tccgtggagtccatcaagaatggcctggtctacatgaagtatgacacgcctttcattttt
gctgaggtgaatagtgacaaggtgtactggcagcggcaggacgatggcagcttcaagatt
gtgtatgtggaggagaaggccatcggcacactcattgtcacaaaggccatcggctccaac
atgcgtgaggacatcacctacctctataagcacccagaaggctcagacgcagagcggaag
gcagtagagacagcagcagcccacggcagcaaacccaatgtgtacgccaaccggggctca
gcggaggatgtggccatgcaggtggaggcacaggacgcggtgatggggcaggatctgatg
gtctccatcatgctgaccaatcacagcagcagccgccgcacagtaaaactgcacctttac
ctctcagtcaccttctatactggtgtcactgggaccatcttcaaggagaccaagaaggaa
gtggagctggcaccaggggcctcggaccgtgtgaccatgccagtggcctacaaggaatac
cggccccaccttgtggaccagggggccatgctgctgaacgtctcaggccatgtcaaggag
agcgggcaggtgctggccaagcagcacaccttccgtctgcgtaccccagacctctccctc
acgttactgggagcggcagtggttggccaggagtgtgaagtacagattgtcttcaagaac
ccccttcccgtcaccctcaccaatgtcgtcttccgactcgagggctctgggttacagagg
cccaagatcctcaatgttggggacattggaggcaatgaaacagtgacactgcgccagacg
tttgtgcctgtgcgaccaggcccccgccagctcattgccagcttggacagcccacagctc
tcccaggtgcacggtgtcatccaggtggatgtggccccagcccctggggacaggggcttc
ttctcagacgctggaggtgacagtcacttgggagagaccatccctatggcatctcgaggt
ggagcttag

DBGET integrated database retrieval system