KEGG   Macaca fascicularis (crab-eating macaque): 102119163Help
Entry
102119163         CDS       T02918                                 

Gene name
GLB1, Lactase, QccE-17236
Definition
(RefSeq) galactosidase beta 1
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00052  Galactose metabolism
mcf00511  Other glycan degradation
mcf00531  Glycosaminoglycan degradation
mcf00600  Sphingolipid metabolism
mcf00604  Glycosphingolipid biosynthesis - ganglio series
mcf01100  Metabolic pathways
mcf04142  Lysosome
Module
mcf_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102119163 (GLB1)
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    102119163 (GLB1)
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    102119163 (GLB1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    102119163 (GLB1)
   00511 Other glycan degradation
    102119163 (GLB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102119163 (GLB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcf04147]
    102119163 (GLB1)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     102119163 (GLB1)
Exosome [BR:mcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102119163 (GLB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 102119163
NCBI-ProteinID: NP_001306360
UniProt: Q60HF6
LinkDB All DBs
Position
2
AA seq 682 aa AA seqDB search
MPGFLVRILPLLLPLLLLGPTRGLRNATRRVFEIAYSQDRFLKDGQPFRYISGSIHYSRV
PRFYWKDRLLKMKMAGLNTIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVIL
RPGPYICAEWEMGGLPAWLLEKEAILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPI
ITVQVENEYGSYFACDFDYLRFLQKRFHHHLGDDVVLFTTDGAHETFLQCGALQGLYTTV
DFGPGSNITDAFQIQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEVVASSLYDILARG
ASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYFALRNVIQKFEKV
PEGPIPPSTPKFAYGKVSLEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQYYGFVLYRT
TLPQDCSNSTPLSSPFNGVHDRAYVAVDGIPQGVLERNRVITLNITGKTGATLDLLVENM
GRVNYGAYINDFKGLVSNLTLDSNILTGWTIFPLDTEDAVRSHLGGWEHRDSGRHDEAWA
HSSSNYTLPAFYVGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLT
LFVPQHILMTSAPNTITVLELERAPCSSDGPELCAVEFVDRPVIGSSQIYDHLSKPVEQR
LMAPPPKKTKIRGWSMYDDESL
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgccggggttcctggttcgcatcctccctctgctgctgcctctgctgcttctgggccct
acgcgcggcttgcggaatgccacccggagggtgtttgaaattgcctatagccaagaccgc
ttcctcaaggatggccagccgtttcgctacatctcaggaagcattcactactcccgcgtc
ccccgcttctactggaaggaccggctgctgaagatgaagatggctgggctgaacaccatc
cagacgtatgtgccctggaactttcatgagccctggccaggacagtaccagttttctgag
gaccatgatgtggaatattttcttcggctggctcacgagctgggactgctggttatcctg
aggcccggaccctacatctgtgcggagtgggaaatgggaggattacctgcttggctgcta
gagaaagaggctattcttctccgctcttccgacccagattacctggcagctgtggacaag
tggttgggagtccttctgcccaagatgaagcctctcctctatcagaatggagggccaatt
ataacagtgcaggttgaaaatgaatatggcagctacttcgcctgtgattttgactacctg
cgcttcctgcagaagcgctttcaccaccatctgggggatgatgtggttctgttcaccacg
gacggcgcacatgagacattcctgcaatgtggggccctgcagggcctctacaccacggtg
gactttggaccaggcagcaacatcacagatgctttccaaatccagaggaagtgtgagccc
aaaggacccttgatcaattctgaattctatactggctggctagaccactggggccaacct
cactccacaatcaagactgaagtggtggcttcctccctgtatgatatacttgcccgtggg
gcgagtgtgaacttgtacatgtttataggtgggaccaattttgcctattggaatggggcc
aactcaccctatgcagcccagcccaccagctacgactatgatgccccactgagtgaggcc
ggggacctcactgagaagtattttgctctgcgaaacgttatccagaagtttgaaaaagta
ccagaaggtcctatccctccatctacaccaaagtttgcatatggaaaggtctctctggaa
aagttaaagacagtgggagcagctctggacattctgtgcccctctgggcccatcaaaagc
ctttatcccttgacatttatccaggtgaaacagtattatgggtttgtgctataccggaca
acacttcctcaagattgcagcaactcaacacctctctcttcacccttcaatggagtccac
gatcgagcgtatgttgctgtggatgggatcccccagggagtccttgagcgaaacagggtg
atcactctgaacataacagggaaaactggagccactctggaccttctggtagagaatatg
ggacgtgtgaactatggcgcatatatcaacgattttaagggtttggtttctaacctgacc
ctcgattccaatatcctcaccggctggacgatcttcccactggacactgaggatgcagtg
cgcagccacctcgggggctgggaacaccgtgacagtggccgccacgatgaagcctgggcc
cacagctcatccaactacacgctcccggccttttatgtggggaacttctccattcccagt
gggatcccagacttgccccaggacacctttatccagtttcctggatggaccaagggccag
gtctggattaatggctttaaccttggccgctattggccagcccggggccctcagttgacc
ttgtttgtgccccagcacatcctgatgacctcagccccaaacaccatcaccgtgctggaa
ctggagcgcgcaccctgcagcagtgatggtccagaactgtgtgctgtggagttcgtggac
aggccagttattggctcatctcagatctacgatcatctctccaaacctgttgagcaaaga
ctcatggccccaccccccaaaaaaacaaagattcgtggctggagcatgtatgatgatgaa
agcctgtga

DBGET integrated database retrieval system