KEGG   Macaca fascicularis (crab-eating macaque): 102120094Help
Entry
102120094         CDS       T02918                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00052  Galactose metabolism
mcf00500  Starch and sucrose metabolism
mcf01100  Metabolic pathways
mcf04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102120094 (MGAM)
   00500 Starch and sucrose metabolism
    102120094 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102120094 (MGAM)
Enzymes [BR:mcf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102120094 (MGAM)
    3.2.1.20  alpha-glucosidase
     102120094 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102120094
NCBI-ProteinID: XP_005551050
LinkDB All DBs
Position
3
AA seq 3641 aa AA seqDB search
MARKKLQKFTTLEIVLSVLLLVLFIISIVLIVLLAKESLKSTAPDPGTTGTPDPGTTTST
QSRTTGPPDPGTTGTTPVSAECPVVNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVP
WCYYSKNHSYHMEGDLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLT
DQTSSRFEVPHEHVQSFSGNAAASLTYRVEISREPFSIKVTRRSNNRVLFDSSIGPLLFA
NQFLQLSTRLPSANVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLC
LEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTTGGILDFYVFLGNTPEQVVQEYLELIG
RPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDPV
NFKGFPEFVNDLHKNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLI
GEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNN
LNNPPFTPRVLDGYLFCKTLCMDAVQHWGKQYDVHNLYGYSMAVATAEAAKTVFPNNRSF
ILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGADICGFALDAPEE
LCRRWMQLGAFYPFSRNHNGQGFKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFF
RAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYD
YETGNQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENK
EAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTE
EPSNVTVKHNGIPSQTSPTVTYDSNLKVAIITDINLLLGEAYTVEWDIKIRDDEKIDCYP
DENGASAENCAARGCIWEASNSSGVPFCYFVNDLYSVSNVQYNSHGATADISLKSSVYAS
AFPSTPVNPLRLDVTYHKNEMLQFKIYDPNNNRYEVPVPLNVPTVPSSTPEGQLYDVLIK
KNPFGIEIRRKSTGTIIWDSQLLGFTFNDMFIRISTRLASKYLYGFGETEHTSYRRDLEW
HTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVFLLNSNAMDVTFQPLPALTYRTT
GGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDEMVA
AQIPYDVQYSDIDYMERQLDFTLSPKFAGFPALINRMKADGMRVILILDPAISGNETQPY
PAFTRGLEDDVFIKYPNDGDIVWGKVWPDFPGVVVNDSLDWDSQVELYRAYVAFPDFFRN
STAKWWKREIEELYNNPQNPERSLKFDGLWIDMNEPSSFVNGAVSPGCRDASLNRPPYMP
YLESRDRGLSSKTLCMESQQILPDGSPVQHYNVHNLYGWSQTRPTYEAMQEVTGQRGVVI
TRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMC
VRWMQLGAFYPFSRNHNTIGTRRQDPVSWDTAFVNISRNVLQTRYTLLPYLYTLIYQAHT
EGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRARWYDYYTG
VDIDARGEWKTLPAPLDYINLHIRGGYILPWQEPAVNTHLSRKNPLGLIIALDENKEAKG
ELFWDDGQTKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSN
VTVKHNGVPSQTSPTVTYDSNLKVAIITDINLLLGEAYTVEWDIKTRDDEKIDCYPDENG
ASAENCIARGCIWEASNSSGVPFCYFVNDLYSVSNVQYNSHGATADISLKSSVYASAFPS
TPVNPLRLDVTYHKNEMLQFKIYDPNNNRYEVPVPLNVPTVPSGTPEGQLYDVLIKKNPF
GIEIRRRSTGTIIWDSQLLGFTFNDMFIRISTRLPSKYLYGFGETEHTSYRRDLEWHTWG
MFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVFLLNSNAMDVTFQPLPALTYRTTGGVL
DFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDDMMAAQIP
YDVQYSDIDYMERQLDFTLSPKFAGFPALINRMKADGMRVILILDPAISGNETQPYPAFT
RGLEDDVFIKYPNDGDIVWGKVWPDFPGVVVNDSLDWDSQVELYRAYVAFPDFFRNSTAR
WWKREIEELYNNPQNPERSLKFDGLWIDMNEPSSFVNGAVSPGCRDASLNRPPYMPHLES
RDRGLSSKTLCMESQQILPDGSPVQHYNVHNLYGWSQTRPTYEAMQEVTGQRGVVITRST
FPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCVRWM
QLGAFYPFSRNHNTIGTRRQDPVSWDAAFVNISRNVLQTRYTLLPYLYTLMYKAHTEGVT
VVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRARWYDYYTGVDMN
ARGEWKTLPAPLDYINLHVRGGYILPWQEPALNTHLSRKNPLGLIIALDENKEAKGELFW
DDGQTKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLVFNEIKILGTEEPSNVTVK
HNGVPSQTSPTVTYDSNLKVAIITDISLLLGEAYTVEWSIKIRDDEKIDCYPDENGASAE
NCTARGCIWEASNSSGVPICHFVNDLYSVSNVQYNSHGATADISLKSSVYASAFPSTPVN
PLRLDVTYHKNEMLQFKIYDPNNNRYEVPVPLNVPTVPSSTPEGQLYDVLIKKNPFGIEI
RRKSTGTIIWDSQLLGFTFNDMFIRISTRLPSKYLYGFGETEHTSYRRDLEWHTWGMFSR
DQPPGYKKNSYGVHPYYMGLEEDGSAHGVFLLNSNAMDVTFQPLPALTYRTTGGVLDFYV
FLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDEMVAAQIPYDVQ
YSDIDYMERQLDFTLSPKFAGFPALINRMKADGMRVILILDPAISGNETQPYPAFTRGLE
DDVFIKYPNDGDIVWGKVWPDFPGVVVNESLDWDNQVELYRAYVAFPDFFRNSTAKWWKR
EIEELYNNPQNPERSLKFDGLWIDMNEPSSFVNGAVSPGCRETSLNRPPYMPYLESRDRG
LSSKTLCMESQQILPDGSPVQHYNVHNLYGWSQTRPTYEAMQEVTGQRGVVITRSTFPSS
GRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCVRWMQLGA
FYPFSRNHNTIGTRRQDPVSWDAAFVNISRNVLQTRYTLLPYLYTLMYKAHTEGVTVVRP
LLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRACWYDYYTGVDMNARGE
WKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRQKFMGFKIALDDEGTAEGWLFWDDGQ
SIDTYGKGLYYLANFSASQNTMQSHIIFNNYITDTNPLKLGYIEIWGVGSVPITSVSISV
SGMAITPSFNNDPTTQVLSIDVTDRNISVHNFTSLTWRSTP
NT seq 10926 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagctgcaaaaatttactactttggagattgtgctcagtgttcttctg
ctcgtgttgtttatcatcagtattgttctaattgtgcttttagccaaggagtcattgaaa
tcaacagccccagatcccgggacaactggtaccccagatcctggaacaaccacttccacg
cagtctaggacaactggtcccccagatcctggaacaactggtaccactcctgtttctgct
gaatgtcccgtggtaaatgaattggaacgaattaattgcatccctgaccagccaccaaca
aaggccacatgtgaccaacgtggctgttgctggaatccccagggagctgtaagtgttccc
tggtgctactattccaagaatcatagctaccacatggagggcgaccttgtaaacacaaat
gcaggattcacagcccggttgaaaaatctgccttcttcacccgtgttcggaagcaatgtt
gacaatgttcttctcacagcagaatatcagacatctaatcgtttccactttaagttgacc
gaccaaaccagtagcaggtttgaagtaccccacgaacatgtgcagtccttcagtggaaat
gctgctgcttctttgacctaccgagttgaaatctccagagagccatttagcatcaaagtg
accagaagaagcaataatcgtgttttgtttgactcaagcattgggcccctcctgtttgcc
aaccagttcttgcagctttccacccgactgcctagtgctaatgtgtatggcctgggagag
catgtgcaccagcagtaccggcatgatatgaattggaagacctggcccatatttaacagg
gacacaactcccaatggaaacggaactaatttgtatggtgcgcagacattcttcctgtgt
cttgaagatgctagtggattgtcctttggggtgtttctgatgaacagcaatgccatggag
gttgtccttcagcctgcgccagccatcacttaccgcaccactgggggcattctcgacttc
tatgtgttcttgggaaacactccagagcaagttgttcaagaatatctagagcttattggg
cggccagcccttccctcctactgggcacttggatttcaccttagtcgttatgaatatgga
accttagacaacatgagagaagtcgtggagagaaatcgcgcagcacagctcccttatgat
gttcagcatgctgatattgattatatggatgagagaagggacttcacttatgatccagtg
aattttaaaggcttccctgaatttgtcaatgacttacacaaaaatggacagaagcttgtc
atcattgtggatccagccatctccaacaactcttcctcaagtaaaccctatggcccatat
gacaggggttcagatatgaagatatgggtgaatagttcagatggagtgactccactcatt
ggggaggtctggcctggacaaactgtgtttcctgattataccaatcccaactgtgctgtt
tggtggacaaaggaatttgaactttttcataatcaagtggagtttgatggaatctggatt
gatatgaatgaagtctccaactttgttgatggttcggtctcaggatgttccacaaacaac
ctaaataatcccccattcactcccagagtcctggatgggtacctgttctgcaagactctc
tgtatggatgcagtgcagcactggggcaagcagtatgacgttcacaatctgtatggctac
tccatggcggttgccacagcagaagctgccaagactgtgttccctaataacagaagcttc
attctgacccgttctacctttgcgggttctggcaagtttgcagcacattggttaggagac
aacaccgccacctgggatgacctgcgatggtccatccctggcgtccttgagttcaacctt
ttcggcatcccaatggtgggtgctgacatatgtggctttgccttggatgcccctgaggag
ctctgtaggcggtggatgcagttgggcgcattttatccattttctagaaatcacaatggc
caaggcttcaaggaccaggatcctgcctcctttggagctgactccctgctgttgaattcc
tccaggcactaccttaacatccgctatactctattgccctacctatacaccctcttcttc
cgtgctcacagccgaggggacacggtggccaggccccttttgcatgagttctatgaggac
aacagcacttgggatgtgcaccaacagttcttatgggggcccggcctcctcatcactcca
gttctggatgaaggtgcagagaaagtgatggcatatgtgcctgatgctgtctggtatgac
tacgagactggaaaccaagtgagatggaggaagcaaaaagtcgagatggaacttcctgga
gacaaaattggacttcaccttcgaggaggctacatctttcccacacagcagccaaataca
accactctggccagtcgaaagaaccctcttggtcttatcattgccctagatgagaacaaa
gaagcaaaaggagaacttttctgggatgatggggaaacgaaggatactgtggccaataaa
gtgtatcttttatgtgagttttctgtcactcaaaaccgcttggaggtgaatatttcacaa
tcaacctacaaggaccccaataatttagcatttaatgagattaaaattcttgggacggag
gaacctagcaatgttacagtgaaacacaatggtatcccaagtcagacttctcctacagtc
acttatgattctaacctgaaggttgccattatcacagatatcaatcttctcctgggagaa
gcatacacagtggagtgggatataaagataagggatgatgaaaaaatagactgttaccct
gatgagaatggggcttctgcagaaaactgtgctgcccgtggctgtatctgggaggcatcc
aattcttctggggtccctttttgctattttgtcaacgatctatactctgtcagtaatgtt
caatataattcacatggggccacagctgacatctccttaaagtcttccgtgtatgccagt
gccttcccctccacacccgtgaacccccttcgcctggatgtcacttaccataagaatgaa
atgctgcagttcaagatttatgatcccaacaacaatcggtatgaagttccagttcctctg
aacgtacccacggtgccatccagcacccctgagggtcaactctatgatgtccttattaag
aagaatccgtttgggattgaaattcgccgcaagagtacaggcactataatttgggactct
cagctccttggtttcaccttcaatgacatgtttatccgcatctccacccgccttgcctcc
aagtacctctatggctttggggaaactgagcacacatcctataggagagacttggagtgg
cacacttgggggatgttctcccgagaccagcccccagggtacaagaagaattcctatggt
gtccacccctactacatggggctggaggaggatggcagtgcccacggagtgttcctgctg
aacagcaatgccatggacgtgacgttccagcccctgcctgccttgacataccgtaccaca
gggggagttctggacttttatgtgttcttggggccaactccagagcttgtcacccagcag
tacacggagttgattggccggcctgtgatggtaccttactggtctttgggtttccagctg
tgtcgctatggataccagaacgactctgagatcgccagcttgtatgatgagatggtggcc
gcccagatcccttatgacgtgcagtactcagacatcgactacatggagcggcagctggac
ttcaccctcagccccaagtttgctgggtttccagctctgatcaaccgcatgaaggctgat
gggatgcgggtcatcctcattctggatccagctatttctggcaatgagacacagccctat
cctgccttcactcggggcttggaggatgacgtcttcatcaaatacccaaatgatggagac
attgtctggggaaaggtctggcccgattttcctggtgttgttgtgaatgactctctagac
tgggacagtcaagtggagctatatcgagcttacgtggccttcccagactttttccgtaat
tcaactgccaagtggtggaagagggaaatagaagaactgtacaacaatccacagaatcca
gagaggagcttgaagtttgatggcctgtggattgatatgaatgaaccatcaagcttcgtg
aatggggcagtttctccaggctgcagggacgcctctctgaaccgccctccctacatgcca
tatttggagtccagggacaggggtctgagcagcaagaccctgtgcatggagagtcagcag
atcctcccagacggctccccggtgcagcactacaacgtgcacaacctgtacgggtggtcc
cagaccagacccacatacgaagccatgcaggaggtgacgggacagcgaggggtcgtcatc
acccgctccacatttccctcttctggccgctgggcaggacattggctgggagacaacacg
gccgcgtgggatcagctgaagaaatctatcattggcatgatggagttcagcctcttcggc
atatcctatacaggagcagatatctgtgggttctttcaagatgctgaatacgagatgtgt
gttcgctggatgcagctgggggccttttaccccttctcaagaaaccacaacaccattggg
accaggagacaagaccctgtgtcctgggatactgcttttgtgaacatttccagaaatgtc
ctgcagaccagatacaccctgttgccatatctgtataccttgatatatcaggcccacacg
gagggcgtcacggttgtgcggcctctgcttcatgagtttgtgtcagaccaggtgacgtgg
gacatagacagtcagttcctgctgggcccagccttcctggtcagccccgtcctggagcgc
aatgccagaaatgtcactgcatatttccctagagcccgctggtacgattactacacgggt
gtggatattgatgcaagaggagagtggaagaccttgccagcccctcttgactacattaat
cttcatatccgtgggggctacatcctgccctggcaagagcctgcagtgaacacccactta
agtcgaaagaaccctcttggtcttatcattgccctagatgagaacaaagaagcaaaagga
gaacttttctgggatgatgggcaaacgaaggatactgtggccaataaagtgtatctttta
tgtgagttttctgtcactcaaaaccgcttggaggtgaatatttcacaatcaacctacaag
gaccccaataatttagcatttaatgagattaaaattcttgggacggaggaacctagcaat
gttacagtgaaacacaatggtgtcccaagtcagacttctcctacagtcacttacgattct
aacctgaaggttgccattatcacagacatcaatcttctcctgggagaagcatacacagtg
gagtgggatataaagacaagggatgatgaaaaaatagactgttaccctgatgagaatggc
gcttctgcagaaaactgcattgcccgtggctgtatctgggaggcatccaattcttctgga
gtccctttttgctattttgtcaacgatctatactctgtcagtaatgttcaatataattca
catggggccacagctgacatctccttaaagtcttccgtgtatgccagtgccttcccctcc
acacccgtgaacccccttcgcctggatgtcacttaccataagaatgaaatgctgcagttc
aagatttatgatcccaacaacaatcggtatgaagttccagttcctctgaacgtacccaca
gtgccatccggcacccctgagggtcaactctatgatgtcctcattaagaagaatccattt
gggattgaaattcgccgcaggagtacaggcactataatttgggactctcagctccttggc
ttcaccttcaatgacatgtttatccgcatctccacccgccttccctccaagtacctctat
ggctttggggaaactgagcacacatcctataggagagacttggagtggcacacttggggg
atgttctcccgagaccagcccccagggtacaagaagaattcctatggggtccacccctac
tacatggggctggaggaggacggcagtgcccacggagtgtttctgctgaacagcaatgcc
atggacgtgacgttccagcccctgcctgccttgacataccgtaccacagggggagttctg
gacttttatgtgttcttggggccaactccagagcttgtcacccagcagtacacggagttg
attggccggcctgtgatggtaccttactggtctttgggtttccagctgtgtcgctatgga
taccagaacgactctgagatcgccagcttgtatgatgacatgatggccgcccagatccct
tatgacgtgcagtactcagacatcgactacatggagcggcagctggacttcaccctcagc
cccaagtttgctgggtttccagctctgatcaatcgcatgaaggctgatgggatgcgggtc
atcctcattctggatccagccatttctggcaatgagacacagccctatcctgccttcact
cggggcttggaggatgacgtcttcatcaaatacccaaatgatggagacattgtctgggga
aaggtctggcccgattttcctggtgttgttgtgaatgactctctagactgggacagtcaa
gtggagctatatcgagcttacgtggccttcccagactttttccgtaattcaactgccagg
tggtggaagagggaaatagaagaactgtacaacaatccacagaatccagagaggagcttg
aagtttgatggcctgtggattgatatgaatgaaccatcaagtttcgtgaatggggcagtt
tctccaggctgcagggacgcctctctgaaccgccctccctacatgccacatttggagtcc
agggataggggtctgagcagcaagaccctgtgcatggagagtcagcagatcctcccagac
ggctccccggtgcagcactacaacgtgcacaacctgtacgggtggtcccagaccagaccc
acatacgaagccatgcaggaggtgacgggacagcgaggggtcgtcatcacccgctccaca
tttccctcttctggccgctgggcaggacactggctgggagacaacacggccgcgtgggat
cagctgaagaaatctatcattggcatgatggagttcagcctcttcggcatatcctataca
ggagcagatatctgtgggttctttcaagatgctgaatatgagatgtgtgttcgctggatg
cagctgggggccttttaccccttctcaagaaaccacaacaccattgggaccaggagacaa
gaccctgtgtcctgggatgctgcttttgtgaacatttccagaaatgtgttgcagaccaga
tacaccctgttgccatatctgtataccttgatgtataaggcccacacggagggcgtcact
gttgtgcggcctctgcttcatgagtttgtgtcagaccaggtgacgtgggacatagacagt
cagttcctgctgggcccagccttcctggtcagccccgtcctggagcgcaatgccagaaat
gtcactgcatatttccctagagcccgctggtacgattactacacgggtgtggatatgaat
gcaagaggagagtggaagaccttgccagcccctcttgactacattaatcttcatgtccgt
gggggctacatcctgccctggcaagagcctgcactgaacacccacttaagtcgaaagaac
cctcttggtcttatcattgccctagatgagaacaaagaagcaaaaggagaacttttctgg
gatgatgggcaaacaaaggatactgtggccaataaagtgtatcttttatgtgagttttct
gtcactcaaaaccgcttggaggtgaatatttcacaatcaacctacaaggaccccaataat
ttagtatttaatgagattaaaattcttgggacggaggaacctagcaatgttacagtgaaa
cacaatggtgtcccaagtcagacttctcctacagtcacttatgattctaacctgaaggtt
gccattatcacagacatcagtcttctcctgggagaagcatacacagtggagtggagcata
aagataagggatgatgaaaaaatagactgttaccctgatgagaatggcgcttctgcagaa
aactgcactgcccgtggctgtatctgggaggcatccaattcttctggagtccctatttgc
cattttgtcaacgatctatactctgtcagtaatgttcaatataattcacatggggccaca
gctgacatctccttaaagtcttccgtgtatgccagtgccttcccctccacacccgtgaac
ccccttcgcctggatgtcacttaccataagaatgaaatgctgcagttcaagatttatgat
cccaacaacaatcggtatgaagttccagttcctctgaacgtacccacggtgccatccagc
acccctgagggtcaactctatgatgtcctcattaagaagaatccatttgggattgaaatc
cgccgcaagagtacaggcactataatctgggactctcagctccttggtttcaccttcaat
gacatgtttatccgcatctccacccgccttccctccaagtacctttatggctttggggaa
actgagcacacatcctataggagagacttggagtggcacacttgggggatgttctcccga
gaccagcccccagggtacaagaagaattcctatggtgtccacccctactacatggggctg
gaggaggatggcagtgcccacggagtgttcctgctgaacagcaatgccatggacgtgacg
ttccagcccctgcctgccttgacataccgtaccacagggggagttctggacttttatgtg
ttcttggggccaactccagagcttgtcacccagcagtacacggagttgattggccggcct
gtgatggtaccttactggtctttgggtttccagctgtgtcgctatggataccagaacgac
tctgagatcgccagcttgtatgatgagatggtggccgcccagatcccttatgacgtgcag
tactcagacatcgactacatggagcggcagctggacttcaccctcagccccaagtttgct
gggtttccagctctgatcaaccgcatgaaggctgatgggatgcgggtcatcctcattctg
gatccagccatttctggcaatgagacacagccctatcctgccttcactcggggcttggag
gatgacgtcttcatcaaatacccaaatgatggagacattgtctggggaaaggtctggccc
gattttcctggtgttgttgtgaatgaatctctagactgggacaatcaagtggagctatat
cgagcttatgtggccttcccagactttttccgtaattcaactgccaagtggtggaagagg
gaaatagaagaactgtacaacaatccacagaatccagagaggagcttgaagtttgatggc
ctgtggattgatatgaatgaaccatcaagcttcgtgaatggggcagtttctccaggctgc
agggagacctctctgaaccgccctccctacatgccatatttggagtccagggacaggggc
ctgagcagcaagaccctgtgcatggagagtcagcagatcctcccagacggctccccggtg
cagcactacaacgtgcacaacctgtacgggtggtcccagaccagacccacatacgaagcc
atgcaggaggtgacgggacagcgaggggtcgtcatcacccgctctacatttccctcttct
ggccgctgggcaggacattggctgggagacaacacggccgcgtgggatcagctgaagaaa
tctatcattggcatgatggagttcagcctcttcggcatatcctatacaggagcagatatc
tgtgggttctttcaagatgctgaatatgagatgtgtgttcgctggatgcagctgggggcc
ttttaccccttctcaagaaaccacaacaccattgggaccaggagacaagaccctgtgtcc
tgggatgctgcttttgtgaacatttccagaaatgtcctgcagaccagatacaccctgttg
ccatatctgtataccttgatgtataaggcccacacggagggcgtcactgttgtgcggcct
ctgcttcatgagtttgtgtcagaccaggtgacgtgggacatagacagtcagttcctgctg
ggcccagccttcctggtcagccccgtcctggagcgcaatgccagaaatgtcactgcatat
ttccctagagcctgctggtacgattactacacgggtgtggatatgaacgcaagaggagag
tggaagaccttgccagcccctcttgaccacattaatcttcatgtccgtgggggctacatc
ctgccctggcaagagcctgcactgaacacccacttaagccgccagaagttcatgggcttc
aaaattgccttggatgatgagggaactgctgagggctggctcttctgggatgatgggcaa
agcattgatacctatgggaaaggactctattacttggccaacttttctgccagccagaat
acgatgcaaagccatataattttcaacaattacatcactgatacaaatcctttgaaactg
ggctacattgaaatctggggagtgggcagtgtccccattaccagtgtcagcatatctgtg
agcggcatggccataacaccctccttcaacaatgaccccacgacacaggtattaagcatc
gacgtgactgacagaaacatcagtgtacataattttacctcattgacatggagaagcact
ccgtga

DBGET integrated database retrieval system