KEGG   Macaca fascicularis (crab-eating macaque): 102121178
Entry
102121178         CDS       T02918                                 

Gene name
PTGDR
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102121178 (PTGDR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mcf04030]
    102121178 (PTGDR)
G protein-coupled receptors [BR:mcf04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    102121178 (PTGDR)
SSDB
Motif
Pfam: 7tm_1 PhoR DUF2892
Other DBs
NCBI-GeneID: 102121178
NCBI-ProteinID: XP_005561315
UniProt: A0A2K5UWJ3 G7PA94
LinkDB
Position
7
AA seq 359 aa
MRSPFYRCQNTTSVEKGNSAMMGAVLFSTGLLGNLLALGLLARSGLGWCSPRPLRPPPSV
FYVLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRRGALVAPVVSAFCLAFCALPFMGFGKLVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVFATVLCNLGAMRNLYAMHRRLQQQRRSCT
RDRAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDIKEKIRTS
EEAEDLRALRFLSVISIVDPWIFIIFRTPVFRMFFHKIFIRPLTYRNWCSSSTHMESSL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgaggtcgcccttctaccgctgccagaacaccacctcggtggaaaagggcaattcggcg
atgatgggagcggtgctcttcagcaccggcctcttgggcaacctgctggccctggggctg
ctggcgcgctcggggctggggtggtgctccccgcgtccactgcgcccgccgccctcggtc
ttctacgtgctggtgtgtggcctgacggtcaccgacttgctgggcaagtgcctcctaagc
cccgtggtgctggctgcctacgctcagaaccggagtctacgggtgcttgcgcccgcattg
gacaactcgctgtgccaagcattcgccttcttcatgtccttctttgggctctcctcgaca
ctgcaactcctggccatggcactggagtgctggctctccctagggcaccccttcttctac
cgacggcacatcaccctgcgccggggcgcactggtggccccggtggtgagcgccttctgc
ctggctttctgtgcgctacctttcatgggcttcgggaagttagtgcagtactgccccggc
acctggtgctttatccagatggtccacgaggagggctcgctgtcggtgctggggtactct
gtgctctactccagcctcatggcgctgctggtcttcgccaccgtgctgtgcaacctcggc
gccatgcgcaacctctacgcgatgcaccggcggctgcagcagcagcggcgctcctgcacc
agggaccgtgccgagccgcgtgcggacgggagggaagcgtccccgcagcccctggaggag
ctggatcaccttctgctgctggcactgatgaccgtgctcttcactatgtgttctctgccc
gtaatttatcgcgcttactatggagcatttaaggatatcaaggagaagatcaggacctct
gaagaagcagaagacctccgagccttgagatttctatctgtgatttcaattgtggaccct
tggatttttatcattttcagaactccggtatttcggatgttttttcacaagattttcata
agacctcttacgtacaggaactggtgcagcagttccactcacatggaatccagtctgtga

DBGET integrated database retrieval system