KEGG   Macaca fascicularis (crab-eating macaque): 102121432
Entry
102121432         CDS       T02918                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
mcf  Macaca fascicularis (crab-eating macaque)
Pathway
mcf00220  Arginine biosynthesis
mcf00330  Arginine and proline metabolism
mcf01100  Metabolic pathways
mcf04020  Calcium signaling pathway
mcf04066  HIF-1 signaling pathway
mcf04146  Peroxisome
mcf04371  Apelin signaling pathway
mcf04926  Relaxin signaling pathway
mcf05010  Alzheimer disease
mcf05014  Amyotrophic lateral sclerosis
mcf05022  Pathways of neurodegeneration - multiple diseases
mcf05133  Pertussis
mcf05140  Leishmaniasis
mcf05142  Chagas disease
mcf05145  Toxoplasmosis
mcf05146  Amoebiasis
mcf05152  Tuberculosis
mcf05200  Pathways in cancer
mcf05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102121432 (NOS2)
   00330 Arginine and proline metabolism
    102121432 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102121432 (NOS2)
   04066 HIF-1 signaling pathway
    102121432 (NOS2)
   04020 Calcium signaling pathway
    102121432 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102121432 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102121432 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102121432 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102121432 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102121432 (NOS2)
   05014 Amyotrophic lateral sclerosis
    102121432 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    102121432 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102121432 (NOS2)
   05152 Tuberculosis
    102121432 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102121432 (NOS2)
   05145 Toxoplasmosis
    102121432 (NOS2)
   05140 Leishmaniasis
    102121432 (NOS2)
   05142 Chagas disease
    102121432 (NOS2)
Enzymes [BR:mcf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102121432 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 102121432
NCBI-ProteinID: XP_005583255
UniProt: A0A2K5V3D8
LinkDB
Position
16
AA seq 1153 aa
MACPWKFLFKTKFHQYTMTGGKDINNNMEKAACATPSLVTQDDLQYHSLSKQQNESPQPL
VGTGKKSPESLVKPDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM
TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARNCSTAREMFEHICRHVRYSTNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVVPLVLQADGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT
ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYSLSCLEEERLLLVVTSTFGNGDCPG
NGEKLKKSLFMLKELTNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGD
ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSSVTWDPHHYRLVQDSQPLDL
SKALSNVHAKNVFTMRLKSRQNLQSLTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQ
PALVQGILERVVDGPAPHQTVRLEALDESGSYWVTDKRLPPCSLSQALTYFLDITTPPTQ
LLLQKLAQVATEATERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTQDGQGPLHHGVCSTWLNSLKPQDPVPCF
IRNASGFHLPEDPSHPCILVGPGTGIAPFRSFWQQRLHDSQHKGVPGGRMTLVFGCRRPD
EDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHEEPGHLY
VCGDVRMAWDVAHTLKQLVAAKLNLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDG
AAAQPRSLEMSAL
NT seq 3462 nt   +upstreamnt  +downstreamnt
atggcctgtccttggaaatttctgttcaagaccaaattccaccagtatacaatgactggg
ggaaaagacatcaacaacaacatggagaaagccgcctgtgccacccccagtctagtgaca
caggatgaccttcagtatcacagcctcagcaagcagcagaatgagtccccgcagcccctc
gtggggacaggaaagaagtctccagaatctctggtcaagccggatgcaaccccattgtcc
tccccacggcacgtgaggatcaaaaactggggcagcgggatgactttccaggacacactt
caccacaaggccaaagggattttgacttgcaggtccaaatcttgcttggggtccattatg
actcccaaaagtttgaccagaggacccagggacaagcctacccctccagatgagcttcta
cctcaagctatcgaatttgtcaaccaatattacggctccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccaa
ctgacgggagatgagctcatcttcgccaccaagcaggcctggcgcaatgccccacgctgc
attgggaggatccagtggtccaacctgcaggtcttcgatgcccgcaactgttccaccgcc
cgggaaatgtttgaacacatctgcagacacgtgcgttactccaccaacaatggcaacatc
aggtcggccatcaccgtgttcccccagcggagcgatggtaagcacgacttccgggtgtgg
aatgctcagctcatccgctacgcgggctaccagatgccagatggcagcatcagaggggat
cctgccaacgtggaattcactcagctgtgcatcgacctgggctggaagcccaagtatggc
cgcttcgatgtggtccccctggtcctacaggctgacggccgtgaccctgagctcttcgaa
atcccacctgaccttgtgcttgaggtggccatggaacatcccaaatatgagtggtttcgg
gaactggagctaaagtggtacgccctgcctgcagtggccaacatgctgctcgaggtgggc
ggcctggagttcccagggtgccccttcaatggctggtacatgggcacagagatcggagtc
cgagacttctgtgacgtccaacgctacaacatcctggaggaagtgggcaggagaatgggc
ttggagacgcacaagctggcctcgctctggaaagaccaggctgtcgttgagatcaacatt
gctgtgctccatagtttccagaagcaaaacgtgaccatcatggaccaccactcagctgca
gaatccttcatgaagtacatgcaaaatgaataccggtcccgtgggggctgcccggcagac
tggatttggctggtccctcccatgtctgggagcatcactcccgtgtttcaccaggagatg
ctgaactacgtcctgtcccctttctactactatcaggtagaggcctggaaaacccatgtc
tggcaggacgagaagcggagacccaagagaagagagattccgttgaaagtcttggtcaaa
gctgtgctctttgcctgtatgctgatgcgcaagacgatggcgtcccgagtcagagtcact
atcctctttgcgacagagacaggaaaatcagaggcgctggcctgggacctgggggccttg
tttagctgtgccttcaaccccaaggttgtctgcatggataagtacagtctgagctgcctg
gaggaggagcggctgctgttggtggtgaccagtacgtttggcaatggagactgccccggc
aatggagagaaactgaagaaatcgctcttcatgctgaaagagctcaccaacaaattcagg
tatgctgtgtttggccttggctccagcatgtaccctcggttctgcgcctttgctcatgac
atcgatcagaagctgtcccacctgggggcctctcagctcacccctatgggagaaggggac
gaactcagtgggcaggaggacgccttccgcagctgggccgtgcaaaccttcaaggcagcc
tgtgagacgtttgatgtccgaggcaaacagcacattcagatccccaagctctacacctcc
agtgtgacctgggacccacaccactacaggctcgtgcaggactcacagcctttggacctc
agcaaagccctcagcaacgtgcacgccaagaacgtgttcaccatgaggctcaaatctcgg
cagaatctacagagtctgacatccagccgtgccaccatcctggtggaactctcctgtgag
gatggccaaggcctgaactacttgccgggggagcacctcggggtttgtccaggcaaccag
cccgccctggtccaaggcatcctggagcgagtggtggacggccccgcaccccaccagaca
gtgcgcctggaggccctggacgagagcggcagctactgggtcactgacaagaggctgccc
ccctgctcgctcagccaggccctcacctacttcctggatatcaccacccccccaacccag
ctgctgctccaaaagctggcccaggtggccacagaagcgactgagagacagaggctggag
gccctgtgccagccctcagagtacagcaagtggaagttcaccaacagccccacgttcctg
gaggtgctggaggagttcccgtccctgcgggtgtctgctggcttcctgctctcccagctc
cccattctgaagcccaggttctactccatcagctcctcccgggatcacacgcccacggag
atccacctgactgtggccgtggtcacgtaccacacccaagatggccagggtcccctgcac
cacggcgtctgcagcacatggctcaacagcctgaagccccaagacccagtgccctgcttc
atacgaaacgccagcggcttccacctccccgaggacccctcccatccttgcatcctggtc
gggcctggcacaggcatcgcccccttccgcagtttctggcagcagcggctccatgactcc
cagcacaagggagtgccgggaggccgcatgaccttggtgtttgggtgccgccgcccagat
gaggaccacatctaccaggaggagatgctggagatggcccagaagggggtgctgcatgcg
gtgcacacagcctattctcgcctgcctggcaagcccaaggtctatgttcaggacatcctg
cggcagcagctggccagcgaggtgctccgtgtgctccacgaggagccgggccacctctat
gtttgcggggatgtgcgcatggcctgggatgtggcccacaccctgaagcagctggtggct
gccaagctgaacttgaatgaggagcaggtcgaggactatttctttcagctcaagagccag
aagcgctatcatgaagatatctttggtgctgtatttccctacgaggcgaagaaggacggg
gcggcagcgcagcccaggagcctggagatgtcagccctctga

DBGET integrated database retrieval system